(data stored in ACNUC7421 zone)

EMBL: AM269962.PE6

AM269962.PE6         Location/Qualifiers
FT   CDS_pept        complement(join(11125..11146,11224..11489,11559..11717))
FT                   /locus_tag="An01g04260"
FT                   /EC_number="3.5.4.1"
FT                   /note="Catalytic activity: cytosine + H(2)O <=> uracil +
FT                   NH(3)."
FT                   /note="Remark: strong similarity to cytosine deaminase FCA1
FT                   - Candida albicans."
FT                   /note="Title: strong similarity to cytosine deaminase FCA1
FT                   - Candida albicans"
FT                   /note="See PMID 9000374"
FT                   /db_xref="GOA:A2Q8G5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G5"
FT                   /inference="profile:COGS:COG0590"
FT                   /inference="profile:PFAM:PF00383"
FT                   /inference="similar to AA sequence:SWISSPROT:FCA1.CANAL"
FT                   /protein_id="CAK36962.1"
FT                   /translation="METDPGFIAAVEEAKQGAAEGGVPIGACLVSKDGKILGRGHNMRV
FT                   QKGSPVLHAEMSALENSGRLPASAYEGATMYTTLSPCDMCTGACILYKVKRVVVGENKS
FT                   FMGGEDYLKSRGKEVVVLDNAECKQLMEKFMKEKPELWNEDISV"
     atggagaccg atcccggatt catcgctgct gtggaagaag ccaagcaagg cgctgctgag        60
     ggtggtgtgc ccattggagc ttgtttggtc tccaaggatg gcaagattct aggccgcggc       120
     cacaatatgc gcgtccagaa gggtagtccc gtgttgcatg ctgagatgtc cgcgctcgag       180
     aactccggtc gtctgcccgc ttcggcctac gaaggcgcta ctatgtacac gaccctgtcg       240
     ccatgcgaca tgtgcaccgg tgcctgcatc ctctacaagg ttaagcgcgt tgttgtgggc       300
     gagaacaaga gcttcatggg tggcgaggac tatcttaaga gccgtgggaa ggaggttgtg       360
     gttttggata atgcagagtg taagcagctg atggagaagt tcatgaagga gaagccggag       420
     ctttggaatg aggacatttc cgtctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page