(data stored in ACNUC7421 zone)

EMBL: AM269962.PE8

AM269962.PE8         Location/Qualifiers
FT   CDS_pept        join(13887..13922,13992..14061,14139..14957,15018..15334)
FT                   /locus_tag="An01g04280"
FT                   /note="Function: Haploid S. cerevisiae cells carrying the
FT                   disrupted YDJ1 gene are inviable for growth in liquid
FT                   media."
FT                   /note="Function: YDJ1p from S. cerevisiae is involved
FT                   mitochondrial and ER import."
FT                   /note="Function: YDJ1p from S. cerevisiae is required for
FT                   normal growth and disruption of its gene results in very
FT                   slow growing cells that have pleiotropic morphological
FT                   defects."
FT                   /note="Localization: YDJ1p from S. cerevisiae
FT                   cofractionates with nuclei and also microsomes, suggesting
FT                   that its perinuclear localization reflects association with
FT                   the ER."
FT                   /note="Remark: has similarity to family of dnaJ heat shock
FT                   proteins."
FT                   /note="Remark: synonyms for Ydj1 from S. cerevisiae are
FT                   Mas5 and YNL064c."
FT                   /note="Similarity: the ORF also shows strong similarity to
FT                   expressed sequence tag seq id no:6895 of patent
FT                   WO200056762-A2 from Aspergillus oryzae."
FT                   /note="Title: strong similarity to dnaJ protein homolog
FT                   Ydj1 - Saccharomyces cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 11014801"
FT                   /note="See PMID 11689685"
FT                   /db_xref="GOA:A2Q8G7"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G7"
FT                   /inference="profile:COGS:COG0484"
FT                   /inference="profile:PFAM:PF00226"
FT                   /inference="profile:PFAM:PF00684"
FT                   /inference="profile:PFAM:PF01556"
FT                   /inference="similar to AA sequence:PIR:S26703"
FT                   /protein_id="CAK36964.1"
FT                   /translation="MVKETKFYDILGVPPTASEAQLKTAYKKGALKYHPDKNTNNPEAA
FT                   EKFKELSAAYETLSDPQKRSLYDQLGEEGLEHGGAGGGMGAEDLFAQFFGGGGGFGGMF
FT                   GGGMRDQGPKKARTIHHVHKVNLEDIYRGKVSKLALQKSVICPGCDGRGGKEGAVKSCT
FT                   GCNGSGMKTMMRQMGPMIQRFQTVCPDCNGEGEIIREKDRCKRCNGKKTTVERKVLHVH
FT                   VDRGVKNGHKIEFRGEGDQMPGVLPGDVVFEIEQKPHPRFQRKDDDLFYQAEIDLLTAL
FT                   GGGTINIEHLDDRWLTVTVAPGEVITPGAIKVIKGQGMPSYRHHDFGNLYIQFDVKFPE
FT                   KDQLKNLELLEQVLPPRMEQSQPPQDAMIEDFELEDIDGSESSQARAHGAASAMDEDDE
FT                   DVPPGAERVQCASQ"
     atggtcaagg aaactaagtt ctacgacatc ctgggggttc ccccgacggc ctctgaggcc        60
     caactcaaga ctgcctacaa gaagggtgcc ctgaagtacc accctgacaa gaacacaaac       120
     aaccccgaag ccgctgagaa gttcaaggaa ttgtctgccg cttacgagac cctctccgat       180
     ccccagaagc gtagcctcta cgaccagctc ggtgaggagg gtcttgagca tggcggtgct       240
     ggcggtggca tgggcgccga ggacctcttt gctcagttct tcggcggcgg cggtggtttc       300
     ggtggcatgt tcggtggtgg catgcgtgac cagggcccca agaaggctcg taccatccac       360
     cacgttcaca aggtcaacct cgaggatatc taccgcggta aggtctcgaa gctggctctg       420
     cagaagtcag tcatttgccc gggttgtgat ggtcgcggtg gtaaggaggg tgctgtcaag       480
     tcgtgtaccg gctgcaatgg ttccggtatg aagaccatga tgcgccagat gggtcccatg       540
     atccagcgct tccagacggt ttgccccgac tgcaatggtg agggcgagat catccgtgag       600
     aaggaccgct gcaagcgctg taacggcaag aagaccaccg tggagcgcaa ggttctccac       660
     gtccacgttg accgtggtgt gaagaacggc cacaagattg aattccgcgg cgagggtgac       720
     cagatgcctg gtgttctgcc cggcgacgtt gttttcgaga ttgagcagaa gccccacccc       780
     cgcttccagc gcaaggacga cgacctcttc taccaggccg agatcgacct gctcactgct       840
     cttggcggtg gtaccatcaa cattgagcac cttgatgacc ggtggttgac cgtgaccgtc       900
     gctccgggcg aggtcatcac tcctggtgct atcaaggtta tcaagggtca gggtatgcct       960
     tcctaccgcc accacgactt cggcaacctc tacatccaat tcgatgtcaa gttccccgag      1020
     aaggatcagc tcaagaacct cgagttgctc gagcaggtcc tgcctcctcg tatggagcag      1080
     tcccagcccc cgcaggacgc catgatcgag gactttgagc tggaggacat tgatggcagc      1140
     gagtcgtctc aggctcgcgc acacggtgcc gccagcgcca tggacgagga tgacgaggat      1200
     gttcctcctg gcgctgagcg tgtgcagtgc gcatcgcagt aa                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page