(data stored in ACNUC7421 zone)

EMBL: AM269962.PE9

AM269962.PE9         Location/Qualifiers
FT   CDS_pept        complement(join(16711..17442,17502..19294,19357..19435))
FT                   /locus_tag="An01g04300"
FT                   /note="Title: strong similarity to protein fragment SEQ ID
FT                   NO:54638 from patent EP1033405-A2 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8G8"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="InterPro:IPR039766"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G8"
FT                   /inference="profile:PFAM:PF04100"
FT                   /protein_id="CAK36965.1"
FT                   /translation="MSATTTTTTPGQMPSNGEVPLDPLDAADYDPIDHLNAIFSHPSTL
FT                   SSVSQVSQSLREYEDELDNDIGALVEDQVTSNAESVERIQAAKADLTELFKKIDDVRDR
FT                   ASRTELAITEMTADIKQLDNAKKNLTLSMTVLKRLQMLTTAYDQLRSLGRTRQYRDCAQ
FT                   LLQAVIQLMAHFKSYRSIDQIALLSRNVADIQRELLEQVCEDFELAFAKGEVGQKRHVL
FT                   SEGCLVMDALGDHAKSRLVTWYCNFQLREYRQVFRNNEEAGSLDNISRRYAWFRRILKN
FT                   YDEEYAPIFPASWRVNEILANIFCEGTREDFKGILSRSVRNGQTIDVNLLLSCLQETLD
FT                   FEHSLERRFVSPSRPSTDTFASSEAPVFGQAISEAFEPYLSVWVEAQDKQLAALIPKYR
FT                   QQPAKPPDEEFDSHIVISSSTDLFTFYRHSLQQCAKLSTGASLAELAKVFAKYLDQYAQ
FT                   VLLYYISERPTGHTPSKVPGTEDLILVLNTADYCYTTCNQLEEKIKGRLDKNLKQSVDL
FT                   QSQADSFMGIASAAVRGLVRKVEIDLEPCWREMRNTPWNRLEGVSDQSSYVGELMSKTQ
FT                   TRCSELLQLLHKQQYARAFADHVVELISNVFIATIFQCKPVAETGAEQMLLDAYTLKTG
FT                   LSSLLPSPAPAGFVKRVNASFAKIEALLKTLQVQPSPPEALVQAYLVHIADQNNANFRK
FT                   ILDLKGIRSRQDQNHLIELFQIHRASDRYAANLQQSNPILTAMQASATPSSGTVSQGLG
FT                   LGTAAASIGASTRFDPTMLGSAIISAAKDGVDRFGTPMSSANTTNLTPGGSAISGALTS
FT                   PASTPGPLGQAQPQGGESTTAAGNLNENLKNIGKFFRRDLGGFGGRFGRSGDDGN"
     atgtccgcca ctactaccac caccaccccc ggccaaatgc cctccaacgg agaggtcccc        60
     ctcgatcctt tggatgcagc ggactatgat ccgatcgacc atttgaacgc aatcttttcc       120
     cacccctcca cattgtcgtc ggtgtcccag gtgtcccagt ccctccgcga atatgaggac       180
     gagctcgaca acgatatcgg cgcactggta gaggaccagg tcacttccaa tgcggagagc       240
     gtcgagcgca tccaggccgc caaggccgac ttgaccgaac tgttcaagaa gattgacgat       300
     gtgcgcgacc gcgcgtccag gacggagctg gccattacgg agatgacggc ggatatcaaa       360
     cagctggata atgcgaagaa gaacctcacg ctgtcgatga cggtcctgaa gagactgcag       420
     atgctaacga cagcctacga ccaattacgt tctctgggcc ggacgcggca gtaccgcgac       480
     tgtgctcagc tgctacaggc ggtcatacag ctgatggcgc atttcaagtc gtatcgctcg       540
     atcgatcaga ttgcgctgct tagtcgaaac gttgcggata tacaacggga gcttctggag       600
     caggtctgcg aggacttcga gttggcgttc gcgaaagggg aagttggcca aaagaggcac       660
     gtgctctcgg agggctgctt ggtcatggat gcgctaggtg atcacgcgaa gtccaggttg       720
     gtgacttggt attgcaactt ccagctacgt gaatatcgtc aggttttcag gaacaacgaa       780
     gaggccggtt cactggacaa catctcgcgg cggtatgcct ggtttaggcg gatcttgaag       840
     aactacgatg aggaatatgc gcccatcttt cccgcatcct ggagggtcaa cgagattctg       900
     gcgaacattt tctgcgaggg cacgcgagag gacttcaagg gcattctctc tcgatcggtg       960
     cgcaatggcc agaccatcga tgttaatctg ctactgtctt gtctacaaga aacattggac      1020
     tttgagcatt ctctcgagcg gcggtttgtc agtccatccc ggccttcaac ggatacgttc      1080
     gcctcgagtg aggcaccagt cttcggtcaa gccatctcag aggcgttcga gccctacctg      1140
     agcgtctggg tagaagccca ggacaagcag ctggctgcgc ttatccctaa ataccggcaa      1200
     caacccgcga agccaccgga tgaagaattc gactcgcaca tcgttatatc ctcttccacc      1260
     gatcttttca cgttctatcg gcactcgttg cagcaatgcg cgaagctatc tactggcgcc      1320
     agccttgcgg agctggctaa ggtattcgcg aagtatctcg atcagtatgc acaggtcctg      1380
     ctttattaca ttagtgaacg gcctacaggt cacactccct caaaggtgcc aggtaccgag      1440
     gaccttatcc tagtgctcaa caccgcggac tattgctata cgacctgcaa ccagttagag      1500
     gaaaagatca agggtaggct ggacaaaaat ctcaaacagt cggtggacct acaaagtcaa      1560
     gcggactcat tcatgggcat tgcatctgca gctgttcgag ggctggttcg taaggtcgag      1620
     attgacctgg agccctgctg gcgggaaatg cgcaacacac cctggaaccg gctggagggc      1680
     gtaagcgatc aaagctccta tgtcggcgag ctgatgtcca agacacagac aagatgctct      1740
     gaactgttgc agctgctgca taagcagcag tatgcccgtg cattcgcaga ccatgttgtg      1800
     gagctgatat cgaacgtatt cattgcgact atcttccaat gcaagccggt tgcggagacc      1860
     ggtgcagagc agatgcttct ggatgcctac accctcaaga ctggcctctc gtcgctcctc      1920
     cccagccccg cgccagcggg tttcgtaaag cgcgtcaacg ccagctttgc gaagattgaa      1980
     gccctcctca agaccctcca agttcaaccg tctcctcccg aggcccttgt ccaggcctat      2040
     ctggtccaca tcgcagacca aaacaacgcc aatttccgca aaatcctcga ccttaagggc      2100
     attcgcagtc gccaggacca gaaccacctc atagaacttt tccaaatcca ccgcgcatct      2160
     gatcgctatg cagcaaacct ccagcagagc aaccctatcc tgaccgccat gcaggcctcc      2220
     gcaacacctt catccggcac cgtctcgcag ggtctcggcc tcggcacggc cgcagcatcc      2280
     attggcgcct ccacccgctt cgaccctacc atgcttgggt ccgccatcat ctccgccgcc      2340
     aaagacggtg tagatcgatt cgggacgccg atgagctcag ccaacacgac caacctgacc      2400
     ccaggtggca gcgccatatc cggcgccttg accagcccgg cctctacccc tgggccgtta      2460
     ggacaggcac aaccccaagg cggggaaagc acgaccgccg ctgggaacct gaacgagaat      2520
     ctgaagaata ttgggaaatt cttccgtcgt gatctcggtg ggtttggagg caggtttgga      2580
     cggagtggtg atgatggcaa ttga                                             2604
//

If you have problems or comments...

PBIL Back to PBIL home page