(data stored in ACNUC7421 zone)

EMBL: AM269963.PE1

AM269963.PE1         Location/Qualifiers
FT   CDS_pept        join(1247..1318,1450..1519,1607..1678,1768..1979)
FT                   /locus_tag="An01g04440"
FT                   /note="Similarity: the C-terminal region of the predicted
FT                   protein shows no similarity."
FT                   /note="Title: strong similarity to hypothetical conserved
FT                   protein SMc00345 - Sinorhizobium meliloti"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I2"
FT                   /inference="profile:COGS:COG3526"
FT                   /inference="profile:PFAM:PF05169"
FT                   /inference="similar to AA sequence:UniProtKB:SME591783.36"
FT                   /protein_id="CAK36979.1"
FT                   /translation="MHNHLPRITIKYCTQCKWLLRAAYFAQELLSTFSTQLGEVALVPA
FT                   TGGTGGEDVDITGTILWDRKTNGGFPEVKVLKSLVRNVVDPSRDLGHTDRALRAANVPV
FT                   QSRDGDEKVVGKSQEQESTTAAAATATKGEEKCEECQ"
     atgcacaacc acctcccccg catcaccatc aaatactgca cccaatgtaa atggttactg        60
     cgcgctgcat acttcgccca agaactcctc tccacattca gcacccaact cggcgaagta       120
     gctctcgttc ctgctaccgg gggtactgga ggtgaggatg ttgatatcac tgggactatt       180
     ctctgggata ggaagacgaa tggggggttt cctgaagtca aagtgctgaa aagtctggtg       240
     aggaatgtcg tcgatccgag tagggatttg ggacatacgg atcgggcttt gagggctgcg       300
     aatgtgccgg tgcagagtcg ggatggggat gaaaaggtcg tggggaagag tcaggagcag       360
     gagtctacta ctgctgctgc tgctactgct acgaaaggag aagagaagtg tgaggagtgt       420
     cagtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page