(data stored in ACNUC7421 zone)

EMBL: AM269963.PE10

AM269963.PE10        Location/Qualifiers
FT   CDS_pept        join(24681..25316,25395..25484,25541..25723,25780..26260,
FT                   26311..26482,26534..26695,26749..27195,27251..27692,
FT                   27728..27856)
FT                   /locus_tag="An01g04520"
FT                   /note="Function: D. melanogaster mus308 encodes a theta DNA
FT                   polymerase involved in DNA repair."
FT                   /note="Function: mus308 is required in D. melanogaster to
FT                   process ethyl nitrosourea (ENU) induced lesions, and may
FT                   play a role in post replication bypass of
FT                   O-alkylpyrimidines, probably mediated by
FT                   recombination,which serves to increase the time available
FT                   for error-free repair of these lesions."
FT                   /note="Similarity: mus308 of D. melanogaster and other
FT                   similar proteins are twice longer than the predicted
FT                   proetin."
FT                   /note="Title: similarity to theta DNA polymerase mus308
FT                   -Drosophila melanogaster"
FT                   /note="See PMID 8417992"
FT                   /note="See PMID 8816490"
FT                   /note="See PMID 9539982"
FT                   /note="See PMID 10343651"
FT                   /note="See PMID 10732683"
FT                   /db_xref="GOA:A2Q8J1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J1"
FT                   /inference="profile:COGS:COG1204"
FT                   /inference="profile:PFAM:PF00270"
FT                   /inference="similar to AA sequence:PIR:T13858"
FT                   /protein_id="CAK36988.1"
FT                   /translation="MSAPPGQPFQTYGFQTSVDIARQRTFEVVPLAGNKRPPDPSADDD
FT                   HRPVGVKHPTTAPGAVGRSVDFIRPSFILPKARLVASDIYPVAETPPVCRGQQPNVFPT
FT                   DHDPAHNPYLSLNHPTYGLPPGLVANFAAAGLSSIYQWQASCLLAPGLLKGDRHLVYTA
FT                   PTGGGKSLVADVLMLKRIIENPGRKAILVLPYVALVQEKLKWLRRIVQDRSIRVTGYYG
FT                   GSRTAASWADTDIAVCTIEKANSLINSAIEECSIGDLGVVVLDELHMLDDEHRGYLLEL
FT                   MVTKLLLLRQRTQIIGMSATLSNTEMLAEWMNAAYFVSTYRPIPIDDYLVYENAIYPAA
FT                   TSRQLFQTISKLKSMSNATLMERMPPDRVIRPSTFRELANPMTNATVALAIDTAGAGHG
FT                   ALVFCGSRHMCQIQAVVMSEAMPAPADNTDELTKRLDLLAELRSLPSGLDPVLEKTLVR
FT                   GVGFHHAGMTAEERELIAQAYDQGVLRTLIATCSLAAGVNLPARRVIINGARMGRELVG
FT                   PAMLRQMCGRAGRKGKDDAGETYLICGDSDLQAVCDLLEAEMPAIESCLAPEKRGLKRA
FT                   LLEAIATGLVSGNDAIKEYVRCTLLYLTVDKKVAYAIMGSALQELATEGLVQLNDDESY
FT                   SSTQLGQAVVASAFAPEDGLFVFEELKRALQAFVMDGDMHIFYLFTPLQAATATPIDWL
FT                   IFRDQLDNLDESGLRALQFVGVSPGFVNTMAQSGASLKENTPEQMNQARIYRRAYTAFQ
FT                   LRDLSNEMPLSAVANRYRIPRGAVQTLAQQCHGFAAGIVKFCQRMNWGMLAAVLDHMRD
FT                   RLEAGARADLLEMAQVTYVKGWTARLLRENGFRNLRALAEADAKDLVPILMMVWQTLMA
FT                   VNPRKTQKNQLHPAEAERYAKKLLAKAEVIVASANKIWGTYG"
     atgtctgcac cacccgggca gccatttcag acctatggct tccagacatc cgtcgatatt        60
     gcccgccagc ggacgtttga ggtagtccca ttggctggaa acaagcgacc cccggaccct       120
     tctgcagacg atgatcacag gccagtggga gtaaaacatc ctacaactgc tcctggtgcg       180
     gttggtcggt cggtagattt tatccgcccc tcgttcatcc ttcccaaggc ccgtctggtc       240
     gccagcgaca tctatccggt tgctgagacg ccgccggtgt gtcgtggcca acagccgaat       300
     gtgtttccta ccgaccatga tcctgcacac aacccctatt tgtccctgaa tcatcccacg       360
     tatggcttgc ctccaggact ggtggctaat tttgccgcag ctgggctcag cagtatctac       420
     cagtggcagg cgtcatgcct tctagcgcca ggtctcctca agggcgaccg acatttagtc       480
     tacacagccc ccacgggcgg agggaagtct ctcgtggccg atgttctgat gctcaagcgt       540
     atcattgaga accccgggcg caaggctatc cttgtccttc cctatgtcgc cttggtacaa       600
     gaaaagctca agtggctcag gcgcatcgta caggatcgat cgattcgtgt cactgggtac       660
     tatggtggaa gcaggactgc tgcatcctgg gcagacacgg acatagctgt ctgcacaatt       720
     gagaaggcga actccttgat caattccgcc attgaagagt gtagcattgg cgacttaggc       780
     gtagtcgttt tggacgagct acatatgctt gatgatgaac atcgcgggta tctgctggaa       840
     ctcatggtca ccaaactact tctcttgcga cagaggaccc aaattattgg catgagtgcc       900
     accctatcga acacagagat gcttgccgag tggatgaatg ccgcttactt tgtgtcgaca       960
     taccgaccaa tcccgattga tgattaccta gtttacgaga atgcaattta tcctgcagca      1020
     acctcgagac agcttttcca aacgatctct aagctgaagt ctatgtctaa cgcaactctt      1080
     atggaacgga tgcccccaga ccgtgttatt cgtccctcga ccttccgcga acttgcaaac      1140
     cccatgacaa atgcgactgt agctctggcg atcgacaccg ctggcgccgg acatggcgcc      1200
     ttggtattct gcggtagtcg ccatatgtgc cagatccaag cagttgttat gagcgaagcg      1260
     atgccggccc cagcggacaa cacagatgag ctcaccaagc gtttagactt gcttgctgag      1320
     ctacgcagtt tgcctagcgg cttggacccg gtcctcgaaa agacgctcgt gagaggcgta      1380
     gggttccacc atgcggggat gacagctgag gagcgcgaac tgatagcgca ggcgtacgac      1440
     caaggtgtct tacgtacact catagcgacc tgcagtcttg cggctggtgt caatctcccg      1500
     gcacggagag ttatcatcaa tggagcccgc atgggcaggg aacttgtcgg tcccgcaatg      1560
     ctgcgacaga tgtgtggaag agctggtcgc aaagggaaag acgatgcggg tgagacttac      1620
     ttgatatgtg gggatagcga cctacaagcg gtctgcgacc tcttagaagc agagatgcct      1680
     gccatcgaaa gctgcctggc cccggagaag agaggactca agagagcact tttggaagcg      1740
     attgcgacgg gacttgtgtc cggtaacgat gccatcaagg aatacgttag atgtaccctt      1800
     ctgtacctga cagtggataa aaaagtagcc tacgctatca tgggttcagc gctgcaagaa      1860
     ttggccaccg agggacttgt acaactgaat gacgacgaat catactcgtc aacacaactt      1920
     ggccaggcag tagtggcttc ggcgtttgca cccgaagatg gtctctttgt ttttgaggag      1980
     ttgaagagag cgttgcaagc ttttgtcatg gacggtgata tgcatatatt ttacttgttc      2040
     acgcccttgc aagcggccac agccactccg atcgactggc ttatctttcg tgatcagttg      2100
     gacaaccttg atgaaagcgg gctacgtgcg ttgcaatttg tcggtgtcag tccaggtttt      2160
     gtaaatacga tggcacaaag tggtgcatca ctcaaggaga atacgccaga acagatgaac      2220
     caggccagga tataccgcag agcgtacacg gcatttcaac ttcgggactt gagtaacgag      2280
     atgccattgt cggcagtagc caatcgctat cggattccgc ggggggcagt tcaaaccctg      2340
     gcacaacaat gtcatggctt tgctgcgggt atcgtgaaat tctgtcagcg aatgaattgg      2400
     ggcatgcttg cggcagtctt ggatcatatg cgagatcgtc tggaggctgg tgcgcgtgct      2460
     gatctgctgg aaatggcgca ggttacctac gtgaaaggat ggactgccag gttactccga      2520
     gaaaatgggt tccgcaatct aagagcattg gcagaggctg atgcgaagga ccttgttcct      2580
     atacttatga tggtgtggca aactttgatg gcagtaaacc cgcggaagac ccagaagaat      2640
     caactgcacc cagcggaggc cgagcgctat gctaaaaagt tgcttgctaa ggcggaggtc      2700
     attgttgcat cggcaaacaa gatatggggt acgtatggct ga                         2742
//

If you have problems or comments...

PBIL Back to PBIL home page