(data stored in ACNUC7421 zone)

EMBL: AM269963.PE11

AM269963.PE11        Location/Qualifiers
FT   CDS_pept        complement(join(28221..28582,28638..29184))
FT                   /locus_tag="An01g04530"
FT                   /note="Similarity: strong similarity to A. niger EST
FT                   EMBLEST:BE760850."
FT                   /note="Similarity: the predicted ORF does not contain
FT                   structural features common to protein kinases."
FT                   /note="Title: similarity to hypothetical MAP3K protein
FT                   kinase-like protein MLD14.3 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8J2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J2"
FT                   /protein_id="CAK36989.1"
FT                   /translation="MMFPPSILFGLAVGIASIVPTIAQSTCNGQAEYCDRRFSNVTQVG
FT                   AHDSPFVGSLLSDNQDLSVTQQLDLGIRFLQGQTHKSELDDTILLCHTSCLLEDAGSLE
FT                   SFLTTVKTWMDSNPDEVVTLLLTNGDSLSVSQFGDVFNSSGISDYAFVPSSSPDTLAMD
FT                   EWPTLRELIGNGTRLVSFLDYGADASTVPYILDEFAYFFETPYDVTNATFPDCSIDRPA
FT                   GASASGRMYIVNHFLDVDILGILIPDKDHASDTNAVSGSGSIGAQADLCYSIYDRLPNF
FT                   ILLDFVDLGEPIAAQSELNGV"
     atgatgttcc ccccatccat cctcttcggc ctggcggtgg gcatagcatc cattgtgcca        60
     actatcgcgc agtccacctg taacggccag gcggagtact gtgatcgccg tttttccaat       120
     gttacccagg tcggcgccca cgacagcccc ttcgttgggt cgctcctctc cgataaccag       180
     gatctcagtg tcacccagca gttggacctg ggaatccgct tccttcaggg ccaaacccac       240
     aaatctgaac tggatgatac catcctcctt tgccacacgt cgtgcctgct ggaggatgcg       300
     ggcagcctgg aatcgtttct aactacagtc aaaacctgga tggacagcaa cccggatgag       360
     gtggtgactc tcctccttac aaacggtgac agtctatcgg tatcgcagtt cggcgatgtc       420
     ttcaacagtt ccggtatctc agactatgcg ttcgtgccca gttcgtctcc agacactttg       480
     gccatggatg aatggccgac cctacgagaa ttgatcggaa atggcacgcg gctggtgtct       540
     ttccttgatt atggcgccga tgcttcgacc gtcccataca tcctcgatga gtttgcgtac       600
     ttcttcgaga ccccttatga tgtgacgaat gcaactttcc ccgactgcag cattgaccgg       660
     cccgctggtg catccgcctc cggacggatg tatattgtca atcattttct ggatgtcgac       720
     atattgggaa tcctcatacc cgataaggat catgcatccg acaccaacgc ggtgtcgggg       780
     tctgggagca ttggagccca ggcagacctg tgctactcca tatacgaccg cttgcccaac       840
     ttcatcctcc tggattttgt cgatttgggt gagccgatcg cggctcaaag tgaactgaat       900
     ggtgtttag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page