(data stored in ACNUC7421 zone)

EMBL: AM269963.PE12

AM269963.PE12        Location/Qualifiers
FT   CDS_pept        join(30044..30231,30527..30859,30916..31315)
FT                   /locus_tag="An01g04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8J3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J3"
FT                   /protein_id="CAK36990.1"
FT                   /translation="MDKESPMLTSAFATFDSSATESIPAINLRNIKYWEIGRCDVSAEL
FT                   MNWMSLPKPSTWNSINRVYQEYQEYQLLLRRWVSPVSLPGRSFSIASSSPVQSKLVAAS
FT                   SPSLDPFLTPFGIISSLPEQLVRLLAVLSPSVCRRPEPDIQPPVDPGQPPLLLPHSSFV
FT                   TSIVETTSASPWSDGHSNIPPMSSMIETSNDWAREDELDLGQEDDEHSPPARNGVSDHV
FT                   NTQEPPDHGPMAYFEEDLPGVASENHVSGKPSPPVDADSTDLPSSPQSGQPGAPGSVDE
FT                   TLSTPDDTPSLHVGRDYVCSALTPR"
     atggacaagg aaagccccat gcttacctcg gcttttgcaa catttgactc ttcagccaca        60
     gagtcgatcc cagcgattaa tttgcggaat attaagtatt gggaaatagg tagatgtgac       120
     gtctccgctg agttgatgaa ttggatgtct cttccgaaac cgtccacgtg gaatagcatc       180
     aatcgcgtat accaagaata ccaagaatac caactcctcc ttcgccggtg ggtatctccg       240
     gtatctctgc ctggccggtc cttctccatt gcctcctcca gtccagttca atccaagctc       300
     gtcgcggcct cttctccttc cctagatcca ttcctcaccc cattcggcat catatcttca       360
     ttacctgaac agctcgtgcg tctcctcgct gtgctgtctc cgagtgtctg ccgccgccct       420
     gagcctgaca tccagccccc cgttgatccc ggccagcctc cacttttatt gccccattcg       480
     agcttcgtga catcgattgt tgagaccacc agcgcctcac cttggagcga tggtcattcg       540
     aacatcccgc cgatgagctc catgatcgag accagtaatg actgggcacg agaggatgag       600
     ctcgacttgg gccaggaaga cgatgaacac tccccgcccg cccgcaacgg tgtctccgac       660
     catgtcaaca ctcaggagcc gccagatcat ggcccaatgg cttacttcga ggaggacctc       720
     cccggcgtag ccagcgaaaa ccatgtttcg gggaaaccaa gccctcctgt tgacgctgat       780
     tccactgacc tcccatcctc gccgcaatcc gggcagcccg gcgctcccgg tagcgtggat       840
     gagaccctct cgacgccaga tgatacccct tctttgcatg ttggtcgcga ctatgtctgt       900
     tccgccctga ctccccgctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page