(data stored in ACNUC7421 zone)

EMBL: AM269963.PE14

AM269963.PE14        Location/Qualifiers
FT   CDS_pept        join(36916..37286,37368..37794,37890..38390)
FT                   /locus_tag="An01g04560"
FT                   /EC_number="3.2.1.6"
FT                   /note="Function: mixed-linked glucanases (MLGases) are
FT                   extracellular enzymes able to hydrolyze beta
FT                   1,3-1,4-glucans."
FT                   /note="Similarity: the C-terminal part of the predicted
FT                   protein has similarity to a calcium binding domain found e.
FT                   g. in a penicillin-binding protein of Bacillus subtilis."
FT                   /note="Similarity: the product of MLG1 of C. carbonum has
FT                   no close similarity to any known protein but does contain a
FT                   motif (EIDI) that occurs at the active site of MLGases from
FT                   several prokaryotes; this motif is conserved in the
FT                   predicted protein."
FT                   /note="Title: strong similarity to mixed-linked glucanase
FT                   precursor MLG1 - Cochliobolus carbonum"
FT                   /note="extracellular/secretion proteins"
FT                   /note="See PMID 9464371"
FT                   /db_xref="GOA:A2Q8J5"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J5"
FT                   /inference="profile:COGS:COG2273"
FT                   /inference="similar to AA sequence:UniProtKB:U81606.1"
FT                   /protein_id="CAK36992.1"
FT                   /translation="MLVAMRRTATLLSALGLTAQLSSAAYTLQDDYSGSGFFDGFSFFT
FT                   DTDPTNGFVDYVDEATAQSNGYISTSGDYVYMGVDHTNVAGSSGRQSVRISSDATYNHG
FT                   LFILDLEHMPGGICGTWPAFWLVGADWPNNGEIDIIEGVNQQSGNDMTLHTSDGCSISS
FT                   SSDFTGSMTTDNCYVYAAGQSSNAGCGITDPDATSYGTAFNANGGGVFATEWTSDAISI
FT                   WFFERGSIPDDIDSGNPDPDSWGSPVARFQGDCDIDSHFDGLQIIFDTTFCGDWAGNVW
FT                   GSGSCASVASSCSSYVANNPGAFVDAYWSINSLKVYQDDGDSTVAGVVDYGDDDDEDED
FT                   DDQDDGDDDSDDDDDDDDDSDSDDDSDDDGDDDDDDDDDDDDDDEDSRPWRGGRNHHGQ
FT                   MLNASTSTSSFPSPSFVKKARWEPRNYMAGMIF"
     atgctcgtcg cgatgcgacg caccgcgact ctcctttcgg ccttaggcct cacggcgcag        60
     ctcagctctg cagcctacac tttacaagac gactactccg gctctggctt cttcgacggc       120
     ttctccttct tcaccgacac cgaccccacc aacggcttcg ttgactacgt tgatgaagcc       180
     accgcccaga gcaatggcta tatctccacc tccggcgact acgtctacat gggtgtcgac       240
     cacaccaacg tcgccggcag tagcggacgt caaagtgttc gcatctccag cgacgccacc       300
     tacaaccatg gtctcttcat cctagacctc gaacacatgc ccggaggtat ctgtggcacc       360
     tggcctgcct tctggctcgt cggcgccgac tggcccaaca acggcgaaat cgacatcatc       420
     gaaggcgtca accaacaatc cggcaacgac atgaccctgc acactagcga cggctgcagc       480
     atctcctcct catcggactt caccggctcc atgaccaccg acaactgcta cgtctacgcc       540
     gcaggccaat ctagtaacgc cgggtgtggt atcactgatc ccgacgctac ctcgtacgga       600
     accgccttca acgcgaatgg cggcggcgtg ttcgcgaccg agtggacttc agatgcgatt       660
     agtatctggt tcttcgaacg ggggagcatc cctgatgata ttgattccgg gaatccggat       720
     ccggattctt ggggttcccc tgttgcgagg tttcaaggtg attgtgatat tgatagtcat       780
     tttgatgggt tgcagattat cttcgatact accttctgcg gcgactgggc cggtaatgtc       840
     tggggctcgg gcagttgtgc gtccgtcgct agctcgtgca gtagttatgt ggcgaataat       900
     ccgggggctt ttgtcgacgc ttactggagt attaattcgt tgaaggttta tcaggatgat       960
     ggtgatagca ctgttgctgg ggtggttgat tatggggatg atgacgacga ggatgaagat      1020
     gatgatcagg atgatgggga cgatgattcc gacgacgatg acgatgacga cgacgactct      1080
     gattcggatg atgattcaga tgatgatggg gacgacgacg acgacgacga cgacgatgat      1140
     gatgatgacg atgaagattc tcgtccctgg aggggaggaa gaaaccatca tggtcagatg      1200
     ctgaacgcgt cgacgtcgac ttcgtcgttc cctagcccgt cgtttgtgaa gaaggccagg      1260
     tgggagccga ggaattatat ggcgggcatg attttctaa                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page