(data stored in ACNUC7421 zone)

EMBL: AM269963.PE15

AM269963.PE15        Location/Qualifiers
FT   CDS_pept        complement(join(38801..40376,40426..40856,40903..41049,
FT                   41105..41518,41575..41897,41953..42011,42091..42134))
FT                   /locus_tag="An01g04570"
FT                   /note="Function: CAP10 of C. neoformans is a cytoplasmic
FT                   protein required for capsule formation."
FT                   /note="Remark: C. neoformans is a pathogenic fungus which
FT                   most commonly affects the central nervous system and causes
FT                   fatal meningoencephalitis primarily in patients with
FT                   AIDS,and produces a thick extracellular polysaccharide
FT                   capsule which is well recognized as a virulence factor."
FT                   /note="Title: strong similarity to capsular associated
FT                   protein CAP10 - Filobasidiella neoformans"
FT                   /note="cytoplasm"
FT                   /note="See PMID 10482503"
FT                   /db_xref="GOA:A2Q8J6"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J6"
FT                   /inference="similar to AA sequence:UniProtKB:AF144574.1"
FT                   /protein_id="CAK36993.1"
FT                   /translation="MVFLSAETGLKAAVGVFLLSCTFISTSYKTTFAFDHPLITAVLAC
FT                   YFAGICLLILSRFIHRIPKIASSAPKYSAIPLTERDQTLEEPFSPISLDSNSSFALTRS
FT                   RSSARWIKLGLLSVLGCIRIALYRDLTFHTECAPDGYAYSIPFLLALYDYWRNQRNRPV
FT                   AKWSAPERPQNAHLRAVATFASRMHNFLFQSRLRYVIAAFFLLTGGYITITFSHGLQST
FT                   YICPNTSSVYTRMRVFTIFSLILDSLILIGAAELASEGSRSGDTIRKPPLASWAYSLLG
FT                   VAIFYTIVVIILVATSDGDDRFISAQYLRSAVGQAVLVTCVVAAASQLIPYYGIAGLAV
FT                   LAGFVTLYFTWASTLFNGQHPFPLIFASRAFAALFFIFAGAVAFLYARTASEDEAQFLY
FT                   RFNLAMRITFAFLTVIGLVLVHQQHSAAHLHPIDLLVYDGRQHHDQWLARANSSQTLTD
FT                   AVRKYRAQYNQHPPPNFDKWYEYAVNRSSLVIDEFDQIYADLLPFRALPPAQIRDMTQK
FT                   LATNPYNEIGAISIRNGKARVQEGIKPTHAWMVISASKMIEKFAEFLPDMDLAFNLNDE
FT                   PRVSVPWEKVSVLRHQARSYGLPPEDSIQTEWSTDRGAQWGPIEPADQTTETMFVDNSF
FT                   KHIFDRYVSSTCPRSSKARSQRIWDRRHICLSCVRPHSLGEFPSDWTAATDICHQPDLA
FT                   SLHGFFLSPASFKVTQDLTPVFSQSTIAGFNDIIFPSPWNYVDKIEYKPSEEHPDANYT
FT                   DKTNTLFWIGSTSEGVSNHGEWKGIPRQRLAHLVNNNTLNSVSVFLPTNETDTYMYEVL
FT                   NGRAPSDILHLDTSVNVIDPIVRCRREDCDDQSKELGAASRVDFQSHWQYRYLFDSDGA
FT                   GFSGRFLPFMQSHSLPFKTGLFRQWFDSRITPWLHFVPIDLRLHGLWSTLAYFAGVDTT
FT                   LTVNGATRHVHMPPHDIEGTWIAEEGRKWANRVIRKEDMEIYFFRLLLEWGRITDDQRD
FT                   VLGYRLDM"
     atggtatttc tctctgctga gaccggcctc aaggccgcgg taggggtatt cttactaagt        60
     tgtaccttta tctcgacgtc ttacaagact actttcgctt tcgaccaccc tctcatcaca       120
     gccgtactgg cctgctactt tgcggggatc tgtcttttaa ttctgagccg attcatccat       180
     cgcataccga agatcgcttc gtctgcacct aaatactccg ccattcctct cacagaacgg       240
     gaccaaacgc tcgaagagcc attttcgccg atcagcttag acagtaacag cagttttgcg       300
     ctcactcgct cgcgcagctc ggcgcgttgg atcaaactag gtctactctc ggtgcttgga       360
     tgcatccgaa ttgctttgta tcgcgacctc actttccaca ctgaatgcgc gccggatgga       420
     tacgcgtatt ccataccttt cttattggcc ctctacgact attggcgcaa tcaacgcaat       480
     cgaccggttg cgaaatggtc cgctcctgag cgtccgcaga atgcgcatct gcgtgccgta       540
     gctacctttg ccagtcgcat gcacaatttc ctctttcaga gccgcctgag atatgtcata       600
     gcggcctttt ttctcctaac tggtggatac atcaccataa cgttcagtca tggcttgcag       660
     tcaacataca tctgccccaa tacttctagt gtatatacgc gcatgcgtgt cttcacgatc       720
     ttcagcctca ttctcgactc gttgatctta atcggcgcgg ctgaactggc gagtgaagga       780
     tcccggtcgg gggacaccat caggaagccg cctttggctt cctgggccta tagcctactg       840
     ggagtggcta tcttttatac catcgttgtt atcattctcg tcgctacttc cgacggcgac       900
     gaccgcttca tcagtgctca atacctacgc agtgcggtgg gtcaagcagt gctggtgact       960
     tgtgtggtcg ctgcggcgtc ccaattgatc ccgtactatg gtatcgctgg gctggctgtg      1020
     ctggcgggct tcgtcacgct ctacttcact tgggcgtcca ctctgttcaa cggacaacat      1080
     ccatttccat tgattttcgc ctcccgcgcc ttcgcggctc ttttcttcat ctttgcggga      1140
     gccgtagcct ttctttatgc tcgaactgct tcagaagatg aagcgcaatt cctatatcga      1200
     ttcaacctgg ctatgcgaat tactttcgct tttcttactg taatcggcct cgtcctggtg      1260
     caccagcagc atagcgccgc gcatctgcat cctattgatc tgcttgtgta cgacgggaga      1320
     cagcaccatg atcaatggct tgcgcgggcc aacagcagtc aaactctcac cgatgctgtt      1380
     aggaagtacc gcgcccagta caatcaacat ccaccaccga attttgataa gtggtacgaa      1440
     tatgctgtca accgatcttc cctagtcata gacgagttcg accaaatata tgcagacctt      1500
     ctacccttcc gcgcattgcc gcctgcgcag atccgggaca tgacgcaaaa gctggcgaca      1560
     aacccttaca atgagatcgg tgcgatcagc atccgcaacg gcaaagctcg agtacaggaa      1620
     gggatcaagc ccacgcatgc gtggatggta attagcgctt ccaagatgat cgagaagttt      1680
     gccgagttcc tcccggatat ggatctcgca ttcaacctga acgatgagcc tcgggtttct      1740
     gttccctggg agaaggtttc ggtactccgg caccaagcga gatcttacgg tttaccaccg      1800
     gaggacagca tccaaaccga atggtcgact gatcgcggtg ctcagtgggg accaattgag      1860
     ccggccgacc agacaacaga aaccatgttc gttgacaact cctttaagca catcttcgat      1920
     cgctacgtga gctccacctg cccacgctcc tccaaagctc gcagtcagcg catctgggac      1980
     cggcgacaca tctgcctcag ctgcgttcgt ccccactcgc tgggagagtt tccgtccgac      2040
     tggaccgctg cgacagacat ctgccaccag cccgaccttg cctctctgca cgggttcttc      2100
     ctgtccccag catccttcaa agtcacacaa gacttgaccc ccgtcttcag ccagagcaca      2160
     atcgccggct tcaacgacat tattttcccc agtccttgga actacgtcga caagattgaa      2220
     tacaagccat cagaagaaca ccccgatgca aactacaccg acaaaaccaa cacactcttc      2280
     tggatcggca gcacatccga aggcgtcagc aaccacggcg aatggaaagg cataccacgc      2340
     caacgcctcg cccacctcgt gaacaacaac acactgaaca gcgtctccgt ctttctcccc      2400
     accaacgaaa cagacacgta catgtacgaa gtccttaacg gccgcgcccc ctccgacatc      2460
     ctccatctcg acacctccgt caacgtcatc gaccccatcg tccgctgccg cagagaagac      2520
     tgcgacgacc aaagcaaaga actcggcgcg gcctcccgcg tcgacttcca atcccactgg      2580
     caatatcgct acttgttcga ctcggacggt gccggcttca gtggccgctt cctccccttc      2640
     atgcagagtc acagtctccc attcaagacc ggtctgttcc gtcaatggtt cgactcacgt      2700
     atcaccccct ggctgcactt tgtgccgatc gatcttcgtc tgcacggatt atggagcacc      2760
     ctggcgtact ttgccggcgt ggacacgact ctcacggtaa atggcgccac aaggcacgtc      2820
     cacatgccgc cgcacgatat cgaggggact tggattgccg aggaggggcg aaaatgggcc      2880
     aaccgagtga ttcgtaagga agatatggag atttacttct tccggttatt gctagaatgg      2940
     ggacggataa ctgatgacca gcgagatgtg ttgggatatc gacttgacat gtaa            2994
//

If you have problems or comments...

PBIL Back to PBIL home page