(data stored in ACNUC7421 zone)

EMBL: AM269963.PE18

AM269963.PE18        Location/Qualifiers
FT   CDS_pept        49654..51201
FT                   /locus_tag="An01g04610"
FT                   /note="Title: similarity to hypothetical protein CAE76271.1
FT                   - Neurospora crassa"
FT                   /db_xref="GOA:A2Q8J9"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J9"
FT                   /inference="profile:PFAM:PF00646"
FT                   /protein_id="CAK36996.1"
FT                   /translation="MSIASPSEGKGMALLPREIFWLVLKHLEPGDVLRCRRVCQSWNVA
FT                   FRIGANLLPMLKKRYPLAREVRQLDSESAESLETPEYDVRISQIFDKVTAKYDYLSRVT
FT                   PQTMHRLKLCDDFGITGERNWFPVQPWEYHASHLMQRIDRPFGETFWSYDDGLLVYPSA
FT                   DHSCLVLMDMETDRKFMVPFMIVGRVIRRVRLQKRVLVIEWAENKAYHWLNDSDGVHRH
FT                   FATSFDVNQKEDGWRVNFRNEWKIMFLGHPLSERDRFYSTHTQTHYAIYIWQPNRSLYT
FT                   ADEDAPIESLSVWDISKPSDYRPSLDPTGRLRVESGGGEEDLGPTIITRFGFRELGFYG
FT                   VRQRGLPAIQSLNITDDDQSIEILEGTCAGRSPQVLVPDEWESEVWVTTIPIVGEGPCR
FT                   RRRADFPLPPYRGNCSLQTNPITFAICDEPWYSIVCESYDEQSQVGYCLYLEEQIWPVE
FT                   TAMFLAVGSPEYAPEPANVLPESLVMELTAMGKVCGTEDYLIGQSHNRELVIFRFDR"
     atgtccattg catccccatc tgaaggcaag ggcatggccc ttctgcccag ggagatcttc        60
     tggcttgtac tgaagcatct cgaacccggc gatgtcctcc gttgccgacg agtgtgtcag       120
     tcctggaacg tcgcctttcg aattggcgcc aatctgcttc caatgttaaa gaaacgatac       180
     ccattagcta gagaggtgcg gcaattagac tctgaaagcg cagaatcact cgaaacgcca       240
     gaatacgacg ttcgcatatc ccagatcttc gataaggtca cggcgaaata cgactatcta       300
     agccgagtaa cgccccaaac aatgcacagg cttaagctct gcgatgactt cggaatcaca       360
     ggcgagagga actggttccc cgtccagccc tgggagtatc acgccagcca tctcatgcag       420
     cgcatcgatc gacccttcgg cgagaccttc tggtcctacg acgacgggct cctagtgtac       480
     ccaagtgcag accattcatg tctcgtcctg atggacatgg aaaccgacag gaaattcatg       540
     gtccctttca tgatcgtcgg gagagtaata cgccgagtcc ggcttcagaa acgagtgctt       600
     gtcatcgaat gggcagaaaa caaagcctac cactggctca acgacagcga cggtgtccac       660
     cgacactttg ctacctcgtt cgacgtaaac cagaaggaag atggctggcg cgttaatttt       720
     cgtaacgaat ggaaaatcat gttcctcggg catcctctga gcgagcgaga tcggttctac       780
     tccacccata cccagaccca ttatgccatc tacatctggc aacccaaccg cagcctctac       840
     actgcagacg aggacgcccc tattgagtcc ctctctgtat gggacatttc caaaccctcc       900
     gattaccgac cttctctaga cccaacaggt cgcttgcgag tcgagtccgg aggtggagaa       960
     gaagatctcg gaccaaccat tatcactcgc ttcgggttca gagaactagg cttctacggc      1020
     gtccgtcagc gaggactccc agcaatacaa tccctcaaca tcaccgacga cgatcaatct      1080
     atagagatcc tcgaaggcac atgcgcgggc cgctcaccgc aggttcttgt tcctgatgaa      1140
     tgggaatctg aggtgtgggt tacgactatc ccaatcgttg gcgagggccc gtgccgacga      1200
     cggcgcgctg actttccgct gccaccgtat cgaggaaatt gtagcttgca gactaatcct      1260
     atcacctttg ctatctgcga tgagccgtgg tattctattg tttgtgagtc gtatgatgag      1320
     cagtctcagg tgggttattg tctttacttg gaagaacaaa tatggccggt cgagacagct      1380
     atgttcttgg ctgttggctc acctgagtat gcacccgagc cggcaaacgt cttgcctgag      1440
     agccttgtaa tggagctcac ggcgatgggg aaggtttgtg ggacagagga ctatctgata      1500
     ggtcagagcc acaatcgtga gcttgttatt ttcaggtttg atagatga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page