(data stored in ACNUC7421 zone)

EMBL: AM269963.PE2

AM269963.PE2         Location/Qualifiers
FT   CDS_pept        complement(join(2547..4534,4601..5606))
FT                   /locus_tag="An01g04450"
FT                   /EC_number="3.1.4.17"
FT                   /note="Catalytic activity: guanosine 3',5'-cyclic phosphate
FT                   + H2O = guanosine 5'-phosphate."
FT                   /note="Function: PDE9A of M. musculus and H. sapiens plays
FT                   a role in signal transduction by regulating the
FT                   intracellular concentration of cyclic nucleotides; this
FT                   phosphodiesterase has a high affinity for cGMP."
FT                   /note="Remark: in mammals a number of isoforms of PDE9A are
FT                   produced by alternative splicing."
FT                   /note="Similarity: the predicted protein is almost twice
FT                   longer as PDE9A of mammals, and the N- and C-terminal
FT                   regions show no similarity."
FT                   /note="Title: similarity to cGMP phosphodiesterase PDE9A
FT                   -Mus musculus"
FT                   /note="See PMID 9624145"
FT                   /note="See PMID 9856478"
FT                   /db_xref="GOA:A2Q8I3"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR036971"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I3"
FT                   /inference="profile:PFAM:PF00233"
FT                   /protein_id="CAK36980.1"
FT                   /translation="MDGIECSAIYIDHRVRSERWVYQGTPEAPAGAESDSGIIEEPESL
FT                   SSDVQVLLGVCKRIYLCQVGTAIANKLAEISDGAQSRCTPIFVFFDIDIHGEEAALQRR
FT                   RASRGSWPDVSPPSPASLRRGFTFTSQWEGAYDLKLLSGLSADIQVQDGPNVIVPVAVL
FT                   RPPFADPTSASPADQPRIPSFPDPQHISKCLDAGAVDVLVTPLDSCRAQALVVQAYRTR
FT                   KTALREQSRFLSRKKLRKHSWVGVNDEQPYAYLREAMVSKLMRGICNPEEVIEEFQDRE
FT                   LDVRPDRADFVREHIAQWGFTAHEFSDDELVLAAFEMLQHALQYPELEQWQLTPGELRT
FT                   FLLACRASYNSFVLYHNFRHAIDVLQSVFCFLLHIGALPPYGPNSPTIDDKCPMASLLT
FT                   PFDTLTLLISAIGHDVGHPGVNNFFLVKLNAPLAQLYNDNSVLEAFHCAAFSQILRRYW
FT                   PTAFKDRQLRKLLISSILATDMGVHQKFMERLGSLQEKFHENNRTVDGWKPQDLELYKT
FT                   LLCGLLIKCADISNVARPWDVAEKWTQILQEEFANQGEMEKEVGMETALFGGPPELGNI
FT                   YKLATGQIGFMSIFALPLFEGVSDILPDLKFTVEHIRSNQSKWHFLADMEKNRQTLQID
FT                   LRPDDLVSPRTQSPIPSLRGLHAPLAINSPKMPIKPALPTSEPVSQRSTADDYFGTAST
FT                   PLASDDSPSDYNENTISPVVSPDTPGPPMDITGCSMPSPDEAASRRSSGVIPEGQTNSP
FT                   SARLSDNMDGCSDAIRASSDPTVLAAVLFANGSAAGNGDTSGRSSARNSSVEGRPSSSR
FT                   HGPPSGRRQHANTASSGRTSGPSNSQRNSCTRTHSVSTYSNNMTPISPSTNATSFLSVD
FT                   SDEKGFPRESISRSDGEWDRANTRPATSNHPSVNAAYPSTRRASDPHNYDAAKVTSPVG
FT                   YGTSSSAQSTTTTGSMKHEGRGPRWDEHGSKEHAPPRKLPKRRSRLRLAFWKRRTHHSH
FT                   QHEVSGET"
     atggatggca tcgaatgctc tgcaatttat atcgaccacc gcgtccgatc agaacgctgg        60
     gtgtatcaag gtacaccgga ggcaccggca ggcgcggagt cggattcggg aataatcgag       120
     gaaccagagt cgctgtcgtc cgacgtccaa gttctgttag gagtttgtaa acgcatctat       180
     ctctgtcagg tcggcacagc tatcgcaaat aagttagcag agataagcga cggggctcag       240
     agtcgctgca cacctatttt cgttttcttc gatatcgata ttcacggcga ggaggccgct       300
     ctgcagcgcc gccgagcaag ccgtggttcg tggccggatg tatcgcctcc gtcgccggct       360
     tccctgcgtc gcggctttac attcacctca cagtgggaag gggcgtacga cctgaagttg       420
     ttgtcgggat tgtccgcgga catccaggtt caagatggcc ccaatgtgat cgttccggtc       480
     gctgttctgc gccctccctt cgccgatccc actagcgcct ctccggccga ccagccccgt       540
     attccgtctt tccctgatcc ccagcatatc tccaagtgcc tggatgccgg tgccgtggac       600
     gtgttagtaa ctccgctgga tagctgtaga gctcaagctc tggttgtcca ggcgtaccgg       660
     actcgtaaaa cggctctccg ggaacagtcg cgcttcctct cccgaaagaa actgcggaag       720
     cactcttggg tgggcgttaa cgacgagcag ccttatgcgt atcttcgaga agccatggtc       780
     tccaagctta tgcgaggcat ctgcaatccc gaagaggtta tcgaagagtt tcaggaccgg       840
     gaactggacg ttcgtcccga ccgtgcggat tttgtaagag aacacattgc acaatggggt       900
     tttaccgccc atgagttttc ggacgacgaa ttggtcttgg ctgcattcga aatgctgcag       960
     catgctctgc agtacccgga actggagcag tggcagctga caccaggtga acttcggacg      1020
     tttctcctgg cctgtcgcgc ctcatataat tcattcgtcc tctaccataa cttccgacac      1080
     gcgatcgatg tgttgcagtc ggttttctgc ttcctgttgc acatcggcgc tcttcccccc      1140
     tatgggccca atagcccgac gattgacgac aaatgtccga tggcctccct cctcacaccg      1200
     ttcgataccc ttacccttct gatctccgcc attggccatg atgtcggcca tccgggcgtg      1260
     aacaactttt tcctagtcaa gctgaatgcc ccgctggcac agctatacaa cgacaattca      1320
     gtcctggagg cattccactg tgctgccttt tcacagatcc tgcgtcgcta ctggccgacc      1380
     gcgttcaagg atcgacaact tcgcaagctt ctgatcagct ccatcctcgc taccgacatg      1440
     ggagtgcacc agaaattcat ggaacggctc ggatcgctcc aggagaagtt ccacgaaaac      1500
     aaccggaccg tggacgggtg gaagccccag gacttggagc tttataagac actgctgtgt      1560
     gggctgctga tcaagtgcgc tgatatcagt aacgtggcgc gcccgtggga tgttgcggag      1620
     aagtggaccc agatcctgca ggaggaattc gccaatcagg gcgagatgga gaaggaggtt      1680
     gggatggaga ctgcactatt cggcggccca ccggaattgg ggaatattta caagctcgcc      1740
     accggccaga ttggattcat gtcgattttc gctctgccgc tgttcgaggg cgtctctgat      1800
     atcctgcccg acctgaagtt cacggtcgag cacatccgca gcaatcagtc caaatggcac      1860
     ttcctcgccg acatggagaa gaaccggcaa accttgcaga ttgatcttcg cccggacgat      1920
     ctggtgtcgc cccgcactca gagtcccatc ccgagtttga ggggcctcca cgcgccgcta      1980
     gccatcaata gtccgaaaat gcccatcaaa ccagcccttc cgaccagtga acctgtgagt      2040
     cagcggtcaa ccgcagatga ttactttggt actgcttcta ccccgctggc ctcggatgat      2100
     tctcccagcg actacaatga gaataccatt agcccagttg tttcgccgga caccccgggc      2160
     ccgcctatgg acatcaccgg ttgttcgatg ccgtcgccag atgaggccgc ctcccggaga      2220
     tcttcggggg tcatccctga ggggcagacc aactcgcctt ctgcccgtct gagcgataat      2280
     atggacggct gctccgacgc gattcgtgct tcgagtgacc ccactgtcct ggcggctgtt      2340
     ctctttgcca atggatctgc tgcaggcaac ggcgacacgt cgggtcgctc cagcgctcgt      2400
     aacagctccg tggaaggaag accgagtagc tcgcgacatg ggccgcccag tggtcgacgc      2460
     cagcacgcga atacagcctc gtcgggacgc acatcggggc cctcgaattc acagcggaac      2520
     agttgcactc gcacccacag cgtcagcacc tacagcaata acatgactcc gatctccccg      2580
     tctacgaatg ccactagctt cctcagcgtg gacagcgacg agaagggctt cccccgcgaa      2640
     agcatcagcc ggagtgacgg cgaatgggac cgggccaaca cgcgaccggc cacatcgaac      2700
     catccatcgg tcaacgctgc atacccgagc acccgccggg cttccgatcc gcacaattac      2760
     gatgctgcca aggtgacgtc gccggtgggg tatggaacga gcagctcggc acaatccacg      2820
     acaacgactg gaagcatgaa gcacgagggg cgtgggcccc ggtgggacga gcacgggtcc      2880
     aaggagcacg cacctccgcg caagttgccg aagcgacgaa gccgactgcg gctggcgttc      2940
     tggaagcggc gcacacatca ctcgcatcag cacgaggtga gcggagagac gtga            2994
//

If you have problems or comments...

PBIL Back to PBIL home page