(data stored in ACNUC7421 zone)

EMBL: AM269963.PE20

AM269963.PE20        Location/Qualifiers
FT   CDS_pept        complement(join(53785..53878,53930..53964,54017..54037,
FT                   54097..54209,54269..54843,55043..55098))
FT                   /locus_tag="An01g04630"
FT                   /EC_number="3.6.3.14"
FT                   /note="Complex: more in detail, ATP3 is a part of the F1
FT                   complex, a water soluble subunit which retain the ATPase
FT                   activity but not the proton-transporting activity."
FT                   /note="Function: ATP3 of S. cerevisiae is a component of
FT                   the H+-transporting ATP synthase complex, a mitochondrial
FT                   membrane-bound enzyme in which transport of protons is
FT                   coupled with ATP synthesis."
FT                   /note="Remark: in the gene model, a non conventional splice
FT                   donor (GC instead of GT) was used in the 3' position of
FT                   exon 4, due to the identity to A. niger EST SEQ ID NO:3921
FT                   of patent WO200056762-A2 and the local identity to the
FT                   fungal homologues."
FT                   /note="Title: strong similarity to gamma chain precursor of
FT                   the H+-transporting ATP synthase Atp3 - Saccharomyces
FT                   cerevisiae"
FT                   /note="localisation:mitochondrion"
FT                   /note="See PMID 7929329"
FT                   /note="See PMID 9857174"
FT                   /note="See PMID 10953875"
FT                   /note="See PMID 7498726"
FT                   /db_xref="GOA:A2Q8K1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K1"
FT                   /inference="profile:COGS:COG0224"
FT                   /inference="profile:PFAM:PF00231"
FT                   /inference="similar to AA sequence:PIR:S55891"
FT                   /protein_id="CAK36998.1"
FT                   /translation="MFSRAVRPAVRAGSIAVSRTAPPNAANFATLREIEGRLKSIKNIE
FT                   KITNTMKVIASTRLTRAQKAMEDSRAYGQTSNTVFENAETKPLEDKKTLLVVASSDKGL
FT                   CGGIHSGLSKATRRMLQQYPDADIVVLGEKAKAQLSRTNPNAIVLSFANVCKDIPTFND
FT                   AQSIADQISQLPTDYASVKIIYNQFINAQSYEAGTVEAYSEEAITQSPNLSTFETDDQT
FT                   LAHLREYALANNLFWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQAAIT
FT                   GELVEIITGATASADM"
     atgttctccc gtgctgttcg tccggctgtg agggctggta gcattgcggt ctcccgcact        60
     gctcctccca atgccgccaa cttcgcgact ctgcgtgaaa tcgagggccg tctcaagtcc       120
     atcaagaaca tcgagaagat caccaacacc atgaaggtca tcgcctccac ccgtcttact       180
     cgcgcccaga aggccatgga ggactctcgc gcctacggtc agacctccaa caccgttttc       240
     gagaacgccg agaccaagcc tctcgaggac aagaagactc tgctcgtcgt cgccagctcc       300
     gacaagggtc tttgcggtgg tatccactcc ggtctcagca aggccactcg tcgcatgctc       360
     cagcagtacc ccgatgccga catcgtcgtc ctcggtgaga aggccaaggc tcagctgtct       420
     cgtaccaacc ccaacgccat cgtcctgagc ttcgccaacg tctgcaagga catccccacc       480
     ttcaacgacg ctcagtccat tgccgaccag atctcccagc tgcccaccga ctacgccagc       540
     gtcaagatca tctacaacca gttcatcaac gcccagtcct atgaggccgg caccgttgag       600
     gcttactctg aggaggctat cacccagtct cccaacctct ctactttcga gactgatgac       660
     cagactctgg cccacctccg tgaatacgcc cttgccaaca acctcttctg ggctatggct       720
     gagggtcacg cttgcgaaat ctccgctcgt cgtaacgcca tggagaacgc ctccaagaac       780
     gctggtgaga tgatcaacaa gttccagatc ttgtacaacc gtcagcgtca agccgccatt       840
     accggtgaac tggttgagat tatcactggt gccaccgcca gtgcggacat gtaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page