(data stored in ACNUC7421 zone)

EMBL: AM269963.PE21

AM269963.PE21        Location/Qualifiers
FT   CDS_pept        join(56107..56161,56347..56564,56660..58216,58267..58506,
FT                   58576..59025,59082..59216)
FT                   /locus_tag="An01g04640"
FT                   /EC_number="5.99.1.2"
FT                   /note="Catalytic activity: ATP-independent breakage of
FT                   single-stranded DNA,followed by passage and rejoining."
FT                   /note="Catalytic activity: when a topoisomerase transiently
FT                   breaks a DNA backbone bond,it simultaneously forms a
FT                   protein-DNA link,in which a tyrosyl oxygen in the enzyme is
FT                   joined to a DNA phosphorus at one end of the enzyme-severed
FT                   DNA strand."
FT                   /note="Function: the reaction catalyzed by topoisomerases
FT                   leads to the conversion of one topological isomer of DNA to
FT                   another; eukaryotic topoisomerase I and II can relax both
FT                   negative and positive supercoils, whereas prokaryotic
FT                   enzymes relax only negative supercoils."
FT                   /note="Similarity: the predicted protein shows very strong
FT                   similarity to the A. nidulans topoisomerase, whose
FT                   catalytic activity was not experimentally reported."
FT                   /note="Title: strong similarity to topoisomerase I CaTOP1
FT                   -Candida albicans"
FT                   /note="nucleus"
FT                   /note="See PMID 9026437"
FT                   /db_xref="GOA:A2Q8K2"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="InterPro:IPR025834"
FT                   /db_xref="InterPro:IPR036202"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K2"
FT                   /inference="profile:COGS:COG3569"
FT                   /inference="profile:PFAM:PF01028"
FT                   /inference="profile:PFAM:PF02919"
FT                   /inference="similar to AA sequence:UniProtKB:CAU41342.1"
FT                   /protein_id="CAK36999.1"
FT                   /translation="MSSSEDDTPLVQANGRRISSHTDSKMRDATETNGHVDPGVSIRFG
FT                   PVQAENDVDMADADAAAVPKRKSRSSVGQRKSYAEPESSEEDDQPLSKRRRTSVKHEDP
FT                   ETDDDVPLALNGRKLPKASETAIGEESDSDVPIERKLASQKKKIQQKAEKDAKVTRKPA
FT                   PPKTTKTAATKRQTNGVKKEPEDVKPSTVKKTAKPTKASDKAALSSQVKRAASSAKSTP
FT                   VKKEESEEAEDADEEEYRWWEDPTKGDGTIKWTTLEHNGVVFPPPYEPLPKNVKMKYDG
FT                   IPVTLHPDAEEVAGFFGGMLNATQHVENPTFQKNFFMDFRDILKKTGGAKDPKGNKVDI
FT                   KDFHKCDFQPIFAYYDNQRQEKKALPPAEKKRLKAEKDAQEAPYMFCMWDGRKQKVGNF
FT                   RVEPPALFRGRGEHPKTGRVKSRVQPEQITINIGKDAPVPPPPEGHKWKEVKHDQEGTW
FT                   LAMWQENINGNYKYVMLAANSDVKGQSDYKKFEKARELKHHIGRIRKDYQKNLKHELMV
FT                   ERQKATAVYLIDQFALRAGNEKGEDEAETVGCCSLKYENVTLKPPNKVVFDFLGKDSIR
FT                   FYDEVEVDAQVFKNLKIFKKAPKKEGDEIFDRLTTSALNKHLSAYMQGLTAKVFRTYNA
FT                   SHTMSTLLKDMKATGNIAEKVKAYNDANRKVAILCNHKRTVAASHANQMEKMSERIKGL
FT                   RYQRWRLKQQMLDLEPSLKKKKGAKYFEMDEDMDLEWVKEHQAFLVEEQRQKIQKKFEK
FT                   DNEKLAAEGEKEMKATELESRLQVAKDLEKKFNKENKTGKVEAEGKAPTVDKIEAAITK
FT                   LEQRIETMELQAQDKEENKEVALGTSKINYIDPRLTVVFSKKFDVPIEKFFSKSLREKF
FT                   EWAIKSVDEDWEF"
     atgagctcct cggaagacga taccccactt gtccaggcaa atggtcgccg tatcagttcc        60
     catacggact cgaaaatgcg cgacgcgacg gaaacaaatg gccatgttga cccaggcgta       120
     tccatccgct ttggtcccgt tcaggccgaa aatgatgttg acatggcgga tgccgacgct       180
     gccgccgttc ccaagcggaa gtcgcgctca agcgtcggtc agagaaagtc ttacgccgaa       240
     cctgagagca gtgaggagga tgatcaaccc ttgagcaagc gacgccgcac ttccgtgaag       300
     cacgaggacc ccgaaacgga cgatgatgta cctttggcgc tcaatggaag aaagcttccc       360
     aaggcgtcgg aaacggctat aggcgaagaa tccgattccg acgtgcccat cgaaagaaaa       420
     ctcgcctctc agaagaagaa gatccagcag aaggcagaga aggatgcgaa agtgacccgc       480
     aagccagccc ctccgaagac tacgaagacc gcagcaacca agaggcagac caatggcgtg       540
     aaaaaagagc ccgaggatgt gaagccttcg accgtcaaga agacggccaa gccgaccaag       600
     gccagtgaca aggctgcatt gtcctcgcag gtgaagcggg ctgcctccag cgccaagtcg       660
     acccccgtca aaaaggaaga gagcgaggag gctgaagacg ccgatgaaga agagtacaga       720
     tggtgggaag acccgaccaa gggtgatggt acgatcaagt ggacgacact cgaacacaac       780
     ggcgtggttt tccctcctcc gtacgagcca ctccccaaga acgtcaagat gaagtatgat       840
     ggcatccctg tcactctcca tcctgatgct gaagaggtgg ccggcttctt cggcggcatg       900
     ctcaatgcga ctcagcatgt tgagaatccc actttccaga agaacttctt catggatttc       960
     cgcgatattc tcaagaagac cggtggcgca aaggacccca agggcaataa agtggacatt      1020
     aaggactttc acaaatgcga cttccagccg atctttgcct actacgacaa tcaacgtcaa      1080
     gagaagaagg ctttgcctcc ggctgagaag aagcgtctga aggctgagaa ggacgctcaa      1140
     gaggcccctt acatgttctg tatgtgggac ggacggaagc agaaagtggg aaacttccga      1200
     gtggaaccgc ctgctctctt ccgtggacgt ggtgagcacc ccaaaactgg ccgcgtgaag      1260
     tctcgcgttc agccggagca aatcaccatc aacatcggca aggatgcgcc tgtcccgcct      1320
     cctccggagg gccacaagtg gaaagaggtc aaacatgatc aagaaggcac atggcttgcc      1380
     atgtggcagg aaaacattaa cggcaactac aagtatgtca tgctcgcggc caactctgac      1440
     gtcaagggcc agagtgatta caagaaattc gagaaggctc gtgaattgaa gcatcacatt      1500
     ggtcgaatcc gcaaggatta ccagaagaac ctcaagcacg agctgatggt cgaacggcaa      1560
     aaggccacgg cagtgtacct tattgaccag tttgctcttc gtgctggtaa cgagaagggt      1620
     gaagacgaag ctgagactgt ggggtgctgc tcgctcaaat acgagaacgt cactctcaag      1680
     cctccaaata aggtcgtctt cgatttcttg ggtaaggaca gtattcgctt ctatgatgag      1740
     gtcgaggtcg acgcgcaggt cttcaagaac ctcaagatct tcaagaaagc acccaagaag      1800
     gagggcgacg aaatcttcga tcggctgact acttccgccc tcaacaagca cttgtcggcc      1860
     tacatgcaag gtctgacggc aaaggtgttc cgtacctaca acgcttccca cactatgtct      1920
     acgctgttga aggacatgaa ggcgacgggt aacattgcag agaaggtgaa ggcgtacaat      1980
     gacgccaatc gcaaggtcgc cattctctgc aaccataagc gaactgtggc tgcatcccat      2040
     gccaatcaga tggaaaagat gagtgaaagg atcaagggac tacggtacca aagatggcgt      2100
     ctaaagcaac agatgctcga tctcgagcct agcttgaaga agaagaaggg cgccaagtac      2160
     ttcgagatgg acgaagatat ggacctcgaa tgggtgaagg agcaccaggc cttccttgtg      2220
     gaagagcagc gccagaaaat ccagaaaaag ttcgaaaagg acaatgaaaa gcttgctgca      2280
     gaaggcgaga aggaaatgaa ggccactgag ctggagagcc gtctccaggt agcgaaggat      2340
     ctggagaaaa agttcaacaa ggagaacaaa accggaaagg tggaagccga aggcaaggcc      2400
     ccgactgtcg ataagattga ggcagcgatc accaagctcg agcagcgcat tgaaacgatg      2460
     gagcttcaag ctcaggataa ggaagagaat aaggaggtcg ctctgggaac ctcgaagatt      2520
     aactacatcg accctcgtct tactgtggtt ttcagcaaga agtttgatgt tcctatcgag      2580
     aagttcttct ccaagtccct ccgggagaag ttcgaatggg ccatcaagtc ggtcgacgag      2640
     gattgggaat tttaa                                                       2655
//

If you have problems or comments...

PBIL Back to PBIL home page