(data stored in ACNUC7421 zone)

EMBL: AM269963.PE22

AM269963.PE22        Location/Qualifiers
FT   CDS_pept        complement(join(60794..61704,61806..61967,62042..62093))
FT                   /locus_tag="An01g04650"
FT                   /note="Remark: the encoded protein also shows weak
FT                   similarities to UDPglucose 4-epimerase galE from Neisseria
FT                   gonorrhoeae."
FT                   /note="Title: strong similarity to sequence SEQ ID NO:12396
FT                   from patent WO200171042-A2 - Drosophila melanogaster"
FT                   /db_xref="GOA:A2Q8K3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K3"
FT                   /inference="profile:COGS:COG0451"
FT                   /inference="profile:COGS:COG1088"
FT                   /protein_id="CAK37000.1"
FT                   /translation="MADEQSKKPAVLIVGGLGFIGRHLALYLHENNLASEVRLVDKVLP
FT                   QLAWLAPEFQEACSKDKFVQADASREQHFPRIFDRANGEQFDYVINCGGETRHSQPDDV
FT                   YEVRSYALTVALGREVARRGIRSFVECSTAHVYKGGSSPRKEDDKLQPWHKLAKWKMKA
FT                   SEELQKIPGLNYCLLRLPHVYGEYDSGYFAMGICLARVHLELEKDLELLYTKDLKINTV
FT                   YVRDAASALWKAAEWRASAPTDGSAPLAFNVVDHGNTRQEDIAQALSEVFKLKCDFLGS
FT                   LASQFAKLNLDDVVDDMNEECLQGWADLLEEKKIERPGPIGPFLEKDVLKDQDMCLDGT
FT                   LFETTTGWKPSRERFNADAVRDMVDSYKRMGWWP"
     atggccgacg aacagagcaa gaagccggcc gtcctgatcg ttggtggttt aggatttatc        60
     ggtcgccatc tcgctctcta cctgcatgaa aataacttgg cctcggaagt ccgactagtt       120
     gacaaggtcc tgcctcagct ggcgtggttg gcccctgagt tccaggaagc ttgctcaaaa       180
     gataaattcg tccaggctga tgccagccgt gaacagcact tccctcgtat ctttgaccgt       240
     gccaatggtg aacaatttga ttatgtgatc aactgtggag gggaaaccag gcattcgcaa       300
     cccgatgacg tctacgaagt ccgcagctac gccctcactg tcgccctggg tcgcgaagtc       360
     gcccgccgag gtatccgctc tttcgttgag tgctcaaccg ctcacgtcta caagggcggc       420
     tcaagtccgc gtaaggaaga tgacaagctg cagccgtggc acaagctggc caagtggaag       480
     atgaaggcca gcgaggagct gcaaaagatt ccaggtctta actactgctt gcttcgtctg       540
     ccccacgtct acggagaata cgactcgggc tacttcgcaa tgggaatctg ccttgctcgc       600
     gttcacctgg agctggagaa ggatctggag cttctttaca ctaaggatct gaagatcaac       660
     accgtatatg tcagggacgc ggccagcgcc ttgtggaaag cggctgaatg gagagcaagc       720
     gctcccacgg acggttcagc gccccttgca ttcaacgtgg tcgaccacgg caatactcgt       780
     caggaagata tcgcacaggc tctgtccgag gtcttcaagc tcaagtgtga ctttttgggt       840
     tctctagctt cccagtttgc gaaactgaac ctcgacgatg ttgtagatga catgaacgag       900
     gaatgcttac aggggtgggc tgatttgctc gaagagaaga agattgaacg gcctgggccc       960
     attggcccgt tcctggaaaa ggatgtgctg aaggaccaag acatgtgtct ggatgggacg      1020
     ctattcgaga cgaccactgg gtggaagcca tcccgagagc gcttcaacgc tgatgccgta      1080
     cgagatatgg ttgacagtta caagcgaatg ggctggtggc catag                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page