(data stored in ACNUC7421 zone)

EMBL: AM269963.PE23

AM269963.PE23        Location/Qualifiers
FT   CDS_pept        complement(join(65019..65846,65920..65995,66302..66660))
FT                   /locus_tag="An01g04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8K4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K4"
FT                   /protein_id="CAK37001.1"
FT                   /translation="MSSPSSPACSSSGAETMKELLDRGEVKASWRDKQFVHFLDLKEEY
FT                   GREFLNLVKEHVEPNRFEWTDILTSENERRACAKDFVAQYGLKYWGTPANRKKYLQEES
FT                   LADEKTLCTYPAQSEEIVRTIEILLLRKAKGYSRLSQEKAKSTQLTKSPFEAGNTSKRK
FT                   STLKETDEDTDKPVYKTRTRSTPSAIRPFKTIVCESEPEAEFQSSAAKKTKKQRTSLAR
FT                   CYTGTPEVQLPPSRGKDGMSAPHQGTFVHRAASQYAKNTKFPATEGSQSVIAAAQYAQD
FT                   TKLLATENNHIGTTASQYFKDTKFLVTASNQVGMAPVWLPFTDFDQATEFLEHMAKQCN
FT                   VMEWSPSEQLKWESMPPQVIAASVRFDWSDFEIRVRRERNEDLLLMLQELSNAWQAEDE
FT                   GKEGASGSVYKIKVMLHIGIC"
     atgtcttctc cctcaagccc tgcctgctcc agcagtggtg cagaaactat gaaagagctt        60
     ctagatcgcg gtgaagtcaa ggcttcttgg cgcgataagc agtttgttca tttcctggat       120
     ctcaaggaag agtacggccg agagttcctt aatctggtga aagaacacgt tgagcctaac       180
     agattcgaat ggaccgatat cctcacctct gagaacgaac gacgcgcctg cgccaaggat       240
     tttgttgcgc agtacggtct gaagtactgg ggcactccgg cgaatagaaa gaaatatctc       300
     caggaagagt cccttgcgga tgagaagacg ctttgcactt atcccgctca gagtgaagag       360
     atcgttcgaa cgattgagat tctgttgtta aggaaggcga agggctactc cagactaagc       420
     caggagaagg caaagtcaac acaactgact aaatcaccct ttgaagccgg gaacacgagc       480
     aagagaaaat ctactctcaa ggagacagac gaagacaccg acaagcccgt gtacaagacg       540
     cggacccgca gtaccccgag cgccattcgg ccgttcaaga ctattgtctg tgaatctgaa       600
     cccgaggctg aattccagag cagtgcggca aagaagacta agaaacagcg cacttctcta       660
     gctagatgct acacgggaac cccagaggtc cagttgccac cctcgagagg gaaggacggt       720
     atgtctgctc cgcatcaggg cacgtttgta caccgtgctg cttctcaata tgcgaaaaat       780
     accaagtttc ctgctacgga gggcagtcag agtgtgatag ctgctgctca gtatgcacag       840
     gataccaaac tccttgctac ggagaacaac cacatcggaa cgactgcttc tcagtatttc       900
     aaggatacta agtttcttgt cacggcgagc aaccaggttg gaatggcccc agtgtggctg       960
     ccattcacgg atttcgatca ggcaacggag ttcctggagc acatggcgaa acaatgcaac      1020
     gtgatggagt ggagcccctc agagcaattg aagtgggaat cgatgccgcc tcaggtcatc      1080
     gcagcgtcgg tcaggtttga ctggtcagac tttgagatcc gcgtgcgtcg agagcgtaat      1140
     gaggatctgc tccttatgtt gcaagagttg tccaatgcct ggcaagccga ggatgaagga      1200
     aaggagggcg cctcgggatc ggtctacaag atcaaagtga tgcttcacat tggcatttgc      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page