(data stored in ACNUC7421 zone)

EMBL: AM269963.PE24

AM269963.PE24        Location/Qualifiers
FT   CDS_pept        complement(join(67438..68362,68414..68541,68619..68719,
FT                   68798..68900))
FT                   /locus_tag="An01g04670"
FT                   /note="Similarity: proline-rich regions lead to a variety
FT                   of unspecific similarities."
FT                   /note="Title: similarity to hypothetical protein F10M23.90
FT                   - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8K5"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="InterPro:IPR039431"
FT                   /db_xref="InterPro:IPR041212"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K5"
FT                   /inference="similar to AA sequence:PIR:T04798"
FT                   /protein_id="CAK37002.1"
FT                   /translation="MASNIPASLRSADIGRYALRAAQLERAKPVVAYWCNFWIVNQIIG
FT                   RGLHTSDDDVKQYTTDLVDKLEQFKSENVDNDAVTDAVAANAYVEQFGLEVLGRAEATM
FT                   KANKVTKQTADTFQAAATFLELCQIWTNPPEPEIAAKIKFCKYHAVRIIKAIKAGEDPN
FT                   ASNPAPTEEDELESELRGMEAKQDDPEVQAIVGSSAAPPGQPSVEEVPDESTQPSQSPL
FT                   SLPQPPTTFADAPAAHYGADPMSTSNMEDDAETGAPLNLPSAPETFTSPAPSVPNLPDT
FT                   PADIGAKPPQARADSFHSFPPPSSIPPSSPSAASHDASSFYTRPTSGVAPPPPFVQSSS
FT                   ATAPVVSRPTPQSIPSSTPPPPAPAASSSSGVNAQSLDDQAIALAQKHARWAVSALTFD
FT                   DVNTAIKELKNSLRYLGAE"
     atggcgagca atatccccgc tagcttgaga tccgcagaca ttgggcgata cgcgttgcgg        60
     gcagctcagc tcgaacgcgc gaagcccgtt gttgcctact ggtgtaactt ctggattgtt       120
     aatcagatta tcggacgggg actgcacact tctgacgacg atgtcaagca atacacaacg       180
     gacctggtgg acaagttgga gcagttcaag agtgagaatg tcgataatga tgcggtaacc       240
     gatgcggtgg cagccaatgc ctacgtggag cagttcggat tggaggtcct tggccgtgcg       300
     gaggcgacta tgaaggccaa taaagtgacc aaacagacgg ccgacacatt ccaagccgct       360
     gctacgtttc tcgaattgtg tcagatttgg accaaccctc cggaacctga gatcgccgcg       420
     aagatcaagt tttgcaagta ccatgccgtg aggatcataa aggctatcaa ggcgggagag       480
     gatcctaatg cgtccaaccc ggcacctact gaagaagatg aactcgaaag tgaacttagg       540
     ggtatggagg caaagcagga cgatcccgaa gtgcaggcca tcgtgggatc gtcagccgca       600
     ccacctgggc agccttctgt tgaagaggtc cctgatgagt ctacacaacc ctcacaatca       660
     ccccttagtc tcccgcaacc tccgaccacg tttgccgatg ctccagctgc tcactacggt       720
     gcagacccca tgtctacttc gaacatggag gacgatgcgg agacaggcgc accgctgaac       780
     cttccctcgg ctccagagac tttcacttca cctgctccct ccgtgcccaa cctcccagat       840
     acgcccgcgg atattggtgc aaaacctccg caagctcgtg ctgactcgtt ccactctttc       900
     cctcccccgt catccattcc gccttcgagc ccgtcggcag catctcacga tgcaagctcg       960
     ttctacacca gaccgacaag cggtgtcgct ccgcctccac cgtttgtaca gtcttcctct      1020
     gcgacagcac ctgtagtttc tcgccctact cctcaaagta tcccgtcatc cacaccacct      1080
     ccacctgcac ctgccgcttc tagttccagt ggggtgaacg ctcagtcact tgacgatcaa      1140
     gctatagctc ttgctcagaa gcatgcccgc tgggccgtgt cagccttgac attcgacgac      1200
     gtcaacaccg cgattaaaga gctgaagaat tcactgcgtt atctcggtgc agagtga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page