(data stored in ACNUC7421 zone)

EMBL: AM269963.PE25

AM269963.PE25        Location/Qualifiers
FT   CDS_pept        complement(join(69298..71214,71271..71502,71574..71947,
FT                   72027..72077))
FT                   /locus_tag="An01g04680"
FT                   /note="Function: palB of A. nidulans is a factor involved
FT                   in ambient pH signalling transduction pathway."
FT                   /note="Remark: calpains are cytosolic cysteine proteases
FT                   that are activated by a rise in intracellular Ca2+, and are
FT                   believed to function in stimulating Ca2+ signaling."
FT                   /note="Title: strong similarity to calpain-like protease
FT                   palB - Aspergillus nidulans"
FT                   /note="cytoplasm"
FT                   /note="See PMID 7499363"
FT                   /note="See PMID 7581026"
FT                   /db_xref="GOA:A2Q8K6"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR036181"
FT                   /db_xref="InterPro:IPR036213"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K6"
FT                   /inference="profile:PFAM:PF04212"
FT                   /inference="similar to AA sequence:UniProtKB:ANPALBGN.1"
FT                   /protein_id="CAK37003.1"
FT                   /translation="MSRPNAASKKFLVNQALKAERDASSALTQGQALESAIDAAENYMK
FT                   ALSLTTESKDRQALDAKCKEWLTRAERIKQDKDWQAVLQIHEKSGLTARFPKSTRKLTT
FT                   REEIILLESAKLNGFIFPPWENAPGPEDFEKGDEGLFTDKPDLHLSKLQRRILAGWERP
FT                   FDLLSKHANGIDGLKSKMPVMSVSGPTDLVQDMLTDCSVVASLCAATSRSERGLDKHHL
FT                   PIVFPCEYGQVNPRISPSGKYIFRFYFNGCFRKVVIDDRLPASKTSRSLHVVDRNHPNF
FT                   LWPAFVEKAYLKLRGGYDFPGSNSGTDLWVLTGWIPEQVFLHQDDVTAEQLWRRLFKRF
FT                   RNGDVLLTIGTGKLTEREQKELGFASEHDYAILDMREQRDRRQMLVKNPWAGDDAITGD
FT                   IADSFALGHTSHTPASSLPRTYWMDCESVLQNFENLYLNWNPGIFRYREDIHFAWDLST
FT                   ARGVAGCFAKNPQFAVTSEVGGKVWLLLGKHFRSIHHDEQTQVPQDDLEPGFISIYVFN
FT                   ANGKRVALSEGALHRGPYVDSPNTLMRLEMPPGTTYTVVVSEQSLPAVSQNFTLSALSD
FT                   NPLLLAPAQNRYACLTKTQGLWMPSTAGGNAESARYPFNPQFRLEVHDDTDISILLEPS
FT                   EPELATHVKLFWSNGERVTRVRNRDIITDSGDYRRGGSLAEKKRLGEGVYTLVCSTFAP
FT                   DQLGRFTLWISSALPCVVKPLAPEAAGRRAVISDIGILTPGKDRMLASLETKRLTRIKL
FT                   IGRSRLSTIGNRAVGPSPMLMTVELGQGPYKEILATSEDGNHSDAISGVRIEDFDLHPG
FT                   LADQGGAWIVIERIGGPGGQVEDHFEVEALAEERVDIGEWIVEDA"
     atgtctagac cgaacgccgc gtctaaaaag ttcttagtga accaagcctt gaaagccgaa        60
     cgagatgcat ctagtgctct tactcaaggc caggcccttg agtctgccat tgacgccgct       120
     gaaaactaca tgaaggcgct gagtctgact accgagtcaa aggatagaca ggctctcgat       180
     gctaaatgta aagaatggct cactcgagca gaaaggatca aacaggacaa ggactggcag       240
     gcggttctcc aaattcatga gaaaagcggt ctcacggcgc gtttccccaa atccacacgt       300
     aaacttacca cccgagaaga gatcattctg ctcgagagcg caaagctgaa cggctttatc       360
     tttcctccat gggaaaatgc gccgggcccc gaggactttg agaagggcga tgaaggcctt       420
     ttcactgaca agccagacct tcatctgtct aaactgcaaa ggcgcattct ggcaggctgg       480
     gagcgtccct ttgatttgtt gtccaaacat gcaaatggta tcgatggcct gaagtcaaaa       540
     atgcctgtaa tgtcggtctc gggccccaca gatctcgtac aagatatgtt gaccgactgc       600
     tccgtcgttg ccagtctttg tgctgctaca tcaaggtccg agcgtggtct agataagcac       660
     catcttccca tagtcttccc ctgtgaatac gggcaggtaa atccaagaat ttctccttct       720
     gggaaataca tttttcgctt ttatttcaat ggatgtttca ggaaagttgt cattgatgat       780
     cgcttgcctg cgtccaaaac atcaagatca cttcatgttg tcgatcggaa ccatcctaac       840
     ttcctatggc cggcctttgt agaaaaggca tatctgaaac ttcgcggggg ttatgatttt       900
     cctgggagca attctggtac agatctgtgg gtcttgacag gttggattcc cgagcaggtt       960
     ttccttcatc aagatgatgt gactgcagag caactctgga gacggctatt caaacgcttc      1020
     cgtaatggcg atgtcctact gacgataggt acgggcaaat taaccgagag ggagcaaaaa      1080
     gaactaggct ttgcgagcga acacgactac gctattttgg atatgagaga acagagagac      1140
     cgtcgccaaa tgcttgtaaa gaacccatgg gcaggtgatg atgcgatcac cggagatatt      1200
     gcagacagtt tcgcacttgg acacacatct cacacccctg cgtcctcttt acctagaaca      1260
     tattggatgg attgcgagag tgtccttcag aatttcgaga atctgtatct gaactggaac      1320
     ccgggaatct ttcgctatcg ggaagatatc cacttcgcat gggacctttc gactgccaga      1380
     ggggtggctg gctgtttcgc gaaaaatcct cagtttgctg tcacctctga ggttggcggc      1440
     aaagtttggc tactacttgg gaagcacttc aggtcgattc atcatgacga acaaactcag      1500
     gtgccccaag acgatctgga accaggattt attagtatct acgtattcaa cgcaaacggg      1560
     aaacgagtgg cattgagtga aggcgctctt catcgtggac catacgttga ctcgccaaat      1620
     actctcatga gacttgaaat gcccccaggc acgacctaca ctgtcgttgt gtccgagcag      1680
     tcattgcccg ctgtcagcca gaacttcaca ttgtcagctc tttccgacaa ccctttactc      1740
     ttggcgcctg ctcagaaccg atacgcttgc ctgacaaaaa ctcagggatt gtggatgccc      1800
     tccacggcag gaggaaacgc cgaatctgcc cgttaccctt tcaatcccca gttccgacta      1860
     gaggttcatg acgatacaga tatctccatc ctgctggaac catcggagcc ggagctcgct      1920
     acgcatgtca agttattctg gtccaatgga gagcgtgtga ctagggttcg gaatcgcgat      1980
     ataatcaccg atagcggtga ctaccggcgt ggcgggtctc ttgcggaaaa aaagagactt      2040
     ggcgaaggag tgtacactct cgtctgttca actttcgccc cggaccagct tggacgattc      2100
     acactctgga tttcgtcagc actaccgtgc gtcgttaagc cgcttgcgcc ggaggcagct      2160
     gggcgacggg cggtcatatc agatattgga atcctgactc ctggaaaaga tcggatgctg      2220
     gcttccttgg agaccaagcg cttgacccgc attaaactga taggacggag cagactgtct      2280
     acgatcggga atcgcgccgt tggcccgtcc ccgatgttga tgacagtaga gctgggtcaa      2340
     gggccgtaca aagaaatact ggctacctct gaagatggaa accacagtga tgcgatatct      2400
     ggagtacgaa ttgaggattt cgatctgcat ccgggtctcg cagatcaggg tggggcctgg      2460
     atagtcattg agagaatcgg gggacctggg ggacaagttg aggaccactt tgaagttgaa      2520
     gctttggccg aggagcgggt ggatatcggc gaatggatcg tcgaggatgc atga            2574
//

If you have problems or comments...

PBIL Back to PBIL home page