(data stored in ACNUC7421 zone)

EMBL: AM269963.PE26

AM269963.PE26        Location/Qualifiers
FT   CDS_pept        join(72939..73039,73112..73656,73712..73949,74000..74123)
FT                   /locus_tag="An01g04690"
FT                   /note="Function: Ant1 of S. cerevisiae is a peroxisomal
FT                   transporter involved in the transport of cytoplasmic ATP
FT                   into the peroxisomal lumen in exchange for AMP."
FT                   /note="Induction: Ant1 of S. cerevisiae is induced by oleic
FT                   acid."
FT                   /note="Localization: Ant1 of S. cerevisiae is localized in
FT                   the peroxisomal membrane."
FT                   /note="Remark: ATP imported into the peroxisome is required
FT                   for the activation of fatty acids."
FT                   /note="Title: strong similarity to peroxisomal transporter
FT                   Ant1 - Saccharomyces cerevisiae"
FT                   /note="peroxisome"
FT                   /note="See PMID 11566870"
FT                   /db_xref="GOA:A2Q8K7"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K7"
FT                   /inference="profile:PFAM:PF00153"
FT                   /inference="similar to AA sequence:PIR:S69019"
FT                   /protein_id="CAK37004.1"
FT                   /translation="MAGQSKPALSPWGSAVAGATGAVLANALVYPLDLVKTKLQVQVKT
FT                   NDAKDENSETVHYKSTLDAITKIVEKEGVEGLYSGIVGSLIGVASTNFAYFYWYTVVRA
FT                   FYMASNKVPKPPGTAIELSLGAVAGAVAQIFTIPVAVITTRQQTQAKNERKGLIETGKE
FT                   IVDSEDGWTGLWRGLKASLILVVNPAITYGAYQRLKDIIFPGKNSLKPWEAFLLGALSK
FT                   ALATIATQPLIVAKVGLQSRPPPSREGKPFKTFGEVMRYIVQNEGLLSLFKGIGPQIMK
FT                   GLLVQGLLMMTKERVELIFVLLFAYLRKIREQKLKKLADSAASTAKTSLPATLK"
     atggcaggcc agtcgaagcc cgcactttcc ccttggggaa gtgccgttgc aggtgctaca        60
     ggtgcggttc tagcgaacgc tttggtctac cctctcgatc tagtcaagac gaagcttcaa       120
     gtacaagtta agacaaacga cgcgaaagac gagaactccg aaacagttca ctataaatcg       180
     acattagatg cgatcaccaa gattgtcgaa aaggaaggag tcgaaggcct atactccgga       240
     atcgttggct cactcatcgg tgtggcgtcc accaacttcg cctacttcta ctggtacacc       300
     gttgtgaggg ccttctatat ggcatctaac aaggtcccta aacctcctgg aactgccatt       360
     gagctttccc tcggtgccgt ggcgggcgcg gtcgcccaga tcttcactat tcccgtcgcc       420
     gtaatcacca cacggcagca gacacaagcc aaaaacgaga ggaagggttt gattgaaact       480
     ggaaaggaga ttgtcgatag tgaagatggt tggaccggtc tatggagagg actcaaagct       540
     agtttgatcc tggtggtcaa ccctgcaatc acatacggcg cctatcagcg cctcaaagat       600
     atcatcttcc caggcaagaa cagtctgaag ccttgggagg ctttcctcct cggcgctctc       660
     tccaaggcgc tagctactat cgcgacgcag ccattgatcg tggctaaggt cggcctccag       720
     tcccgcccac ctccgagccg cgaaggaaag cctttcaaga cattcggcga agttatgcgc       780
     tatattgtgc agaacgaggg tctcctgtcc ctattcaagg gaattggacc ccagatcatg       840
     aagggactcc ttgtgcaagg ccttttgatg atgactaagg agagggttga actcatcttc       900
     gttcttcttt tcgcatacct gcgcaagatt agagagcaga agctcaagaa gctggcggac       960
     tctgctgcat cgacagcgaa gaccagtctt ccggcgaccc tcaaatag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page