(data stored in ACNUC7421 zone)

EMBL: AM269963.PE28

AM269963.PE28        Location/Qualifiers
FT   CDS_pept        complement(join(76065..76597,76678..76849))
FT                   /locus_tag="An01g04710"
FT                   /EC_number="2.7.4.3"
FT                   /note="Catalytic activity: ATP + AMP = ADP + ADP."
FT                   /note="Function: adenylate kinase is required for cell
FT                   maintenance and cell growth."
FT                   /note="Localization: adenylate kinase ADK2 from S.
FT                   cerevisiae is located in the mitochindrial matrix."
FT                   /note="Remark: ADK2 of S. cerevisiae is also known as
FT                   AKY3,PAK3 and YER170W."
FT                   /note="Similarity: adenylate kinases are highly conserved."
FT                   /note="Title: strong similarity to adenylate kinase Adk2
FT                   -Saccharomyces cerevisiae"
FT                   /note="See PMID 9425120"
FT                   /note="See PMID 1587477"
FT                   /note="See PMID 1620094"
FT                   /db_xref="GOA:A2Q8K9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028586"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K9"
FT                   /inference="profile:COGS:COG0563"
FT                   /inference="profile:PFAM:PF00406"
FT                   /inference="profile:PFAM:PF05191"
FT                   /inference="similar to AA sequence:PIR:S23568"
FT                   /protein_id="CAK37006.1"
FT                   /translation="MTATIRQLRKAARIILIGAPGVGKGTQTERLLTRYPELASISSGD
FT                   LLRENVRRKTPLGLQAEATMQSGNLVPDSMILDLISSEFKSRGWLSSAPTSSILPSASF
FT                   ILDGFPRTATQASSLETIVPVNFVVHLVTPPSVILSRIASRWVHEPSGRVYNTDFNAPK
FT                   VPGKDDVTGEPLTQREDDSIDTWKQRLHKFEETSKALLEHYQRKGCLWRVEGDTSDEIS
FT                   PKLFAEIERQFC"
     atgaccgcca caatccggca gctcagaaaa gcagcccgga ttattctcat cggtgctcct        60
     ggtgtcggca agggtacgca aactgagcgg ctcctcacca gatacccaga gctcgcctca       120
     attagctccg gcgaccttct tcgtgaaaat gtccggcgga agacacctct aggccttcaa       180
     gcagaagcca caatgcagtc cggcaacctt gtccccgact cgatgatcct cgatctcata       240
     tcctctgaat tcaaatctcg cggctggctt tcgtcagcgc cgacttcatc gatattgccc       300
     tctgcatctt ttatcctgga cggcttcccg cgcaccgcga cccaggcctc aagcctagaa       360
     accatcgtcc ccgtgaattt cgtcgtccac ctcgttacac ctccttccgt cattctctct       420
     cgcatcgcgt cgcgctgggt acacgaaccg tccgggaggg tttacaatac cgatttcaat       480
     gcgcctaaag ttcctggtaa ggacgatgtc acaggagagc ctctgactca gagagaagat       540
     gactcgatcg atacgtggaa gcagcgattg cacaaatttg aagagacgag caaggcgttg       600
     ctagaacatt atcagcgcaa gggctgtttg tggcgtgtcg agggcgacac aagcgacgag       660
     atcagcccga agcttttcgc agagattgag cggcagttct gctag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page