(data stored in ACNUC7421 zone)

EMBL: AM269963.PE3

AM269963.PE3         Location/Qualifiers
FT   CDS_pept        complement(join(5662..5911,6331..6398,6515..6547))
FT                   /locus_tag="An01g04455"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8I4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I4"
FT                   /protein_id="CAK36981.1"
FT                   /translation="MCRDLSVFPRWPNFYQSLRHLALLLTSVDPLPHLTQFRIQLYNVT
FT                   DRKSLLFFFTSTFSTLLRSSLYPYTGRSFLPEISRPSHSTCTTISINHMNPSSDRLGCY
FT                   LFSFHICCCPET"
     atgtgtcgcg atctctctgt cttcccccgt tggccgaatt tctaccaatc tcttcgccat        60
     cttgctcttc ttcttacctc tgtcgatcct cttccgcact taacccaatt tagaatccaa       120
     ctgtataacg tcaccgatcg caagtctctc cttttttttt ttacttcgac cttctcaacg       180
     ctccttcgct cctctttgta cccttatacc ggccgttcgt ttctccctga gatatctcga       240
     ccctcccact ccacctgtac taccatatcc atcaaccata tgaacccgag ttcggaccgg       300
     ctaggctgct atctcttctc ctttcacatc tgttgctgtc ccgagacttg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page