(data stored in ACNUC7421 zone)

EMBL: AM269963.PE30

AM269963.PE30        Location/Qualifiers
FT   CDS_pept        join(80270..80362,80419..80549,80614..80908,80974..81444,
FT                   81501..82598,82653..82846,82904..82928)
FT                   /locus_tag="An01g04730"
FT                   /note="Complex: sec23 interacts with 5 other
FT                   proteins,namely sec13, sec16, sec24, sec31 and sar1, to
FT                   form the coat protein II - coated vesicle (COPII) complex."
FT                   /note="Function: sec23 is required for transport of
FT                   secretory, plasma membrane and vacuolar proteins from the
FT                   endoplasmic reticulum to the Golgi apparatus."
FT                   /note="Localization: sec23 is located on the cytoplasmic
FT                   surface of either the cytoskeleton or the membrane."
FT                   /note="Remark: sec23 binds directly to the C-terminus of
FT                   sec16."
FT                   /note="Similarity: sec23 is highly conserved."
FT                   /note="Title: strong similarity to secretory protein Sec23
FT                   - Saccharomyces cerevisiae"
FT                   /note="See PMID 8930902"
FT                   /note="See PMID 1498369"
FT                   /note="See PMID 2670558"
FT                   /db_xref="GOA:A2Q8L1"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037364"
FT                   /db_xref="InterPro:IPR037550"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8L1"
FT                   /inference="profile:COGS:COG5047"
FT                   /inference="profile:PFAM:PF00626"
FT                   /inference="profile:PFAM:PF04810"
FT                   /inference="profile:PFAM:PF04811"
FT                   /inference="profile:PFAM:PF04815"
FT                   /protein_id="CAK37008.1"
FT                   /translation="MDYEALKDQWSDVEDRDGIRLSWNTFPSSRMEASRLVVPIGAVYT
FT                   PLKEKPDSPLLQYEPVTCKAPCRAVLNPYANVDVRARIWICPFCLMRNPLPPHYKDITE
FT                   STIPPELHPMSTTIEYQLARPAPAPPIFVYVVDTCQDDDSLKALKDSLIMSLSLLPVNA
FT                   LVGLITYGTMAQVHELGYTECAKSYVFRGSKEYAAKQVQEMLGLASGLRPNMPQQPARP
FT                   PLGPAARFLLPVQQAEFQITNVLEQLQRDPWPVANDKRPLRCTGVALSVAVGLLETSFQ
FT                   NAGGRIMVFTSGPATEGPGHVVGPELKEPIRSHHDIDRDNIKYYKKAVKFYDNMAKRAA
FT                   NNGHIVDVFAGCLDQVGMLEMKNLANYTGGHILLTDSFTSSQFKQSFVRIFDKDAKDNL
FT                   LMGFNASLEVLTTKELKVTGLIGHAVSLNKKSSSVGETECGIGNTCAWKMCGIDPASSY
FT                   GVYFEIANQGGPAAVQPGPQRGMMQFLTYYQHSSGHYHLRVTTVARPLSGPAGDPTLAQ
FT                   SFDQEAAAVLMARIAVFKAEVDDGPDVLRWVDRMLIRLCSRFADYRKDDPTSFRLEKNF
FT                   TLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDVGDSLVMIQPTLDSYSLEHEGS
FT                   QPVLLDSASIQPAHILLLDTFFHILIFHGETIAEWRKAGYQDQEGYENLKVLLEQPKED
FT                   ARELISDRFPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGGYGGGVTSQIIFTDDVSLQ
FT                   TFMDHLMKLAVSGTS"
     atggactacg aagcgttgaa ggaccaatgg agtgatgtcg aggatcgcga tggcatcaga        60
     ctcagctgga acacgtttcc gagctctcgc atggaagcat cccgccttgt tgtccccatc       120
     ggtgccgtct acacacccct caaggagaag ccagactctc cgttgctaca atatgagccc       180
     gtcacttgca aggcgccttg tcgggcggtg ctgaatcctt atgccaacgt tgacgttcgg       240
     gcccgcatct ggatatgccc cttctgcctt atgcgcaacc ccctgccccc tcactacaag       300
     gatatcacgg agagcacgat acccccagag cttcacccga tgagcacgac aatcgagtac       360
     caattggcac gccccgcccc tgctccccct atcttcgtct atgttgtcga tacttgccag       420
     gacgatgaca gtctgaaggc cttgaaggac tctctgatca tgagtctgtc gttgctgcct       480
     gtgaacgcgt tggttggtct gatcacatac ggtacaatgg cacaagtaca tgaactcggc       540
     tacaccgagt gcgccaagtc ctatgtgttc cgcggcagca aggaatacgc cgcgaagcag       600
     gtccaggaga tgcttggtct tgcttccgga cttcgcccga acatgcccca gcaacccgcg       660
     cgtcccccgc ttggccctgc ggcgcggttc ctccttcccg ttcagcaggc cgagttccag       720
     atcacgaacg tgctcgaaca gcttcagcgt gacccgtggc ctgttgcgaa cgacaagcga       780
     cctctcagat gcactggtgt tgctctcagc gtcgccgtgg gtctactcga gacctctttc       840
     cagaatgctg gtggccgcat catggttttc accagtggtc cggccactga gggtcccggc       900
     cacgtcgtcg gacctgagct gaaggagccc atccgttcac accacgatat tgaccgcgat       960
     aacatcaaat attacaagaa ggctgtcaag ttctatgaca acatggctaa gcgtgctgcc      1020
     aacaacggac atattgttga tgtctttgcc ggctgtctcg atcaggtcgg tatgctggag      1080
     atgaagaacc ttgccaacta caccggtgga catatccttc tcacagacag cttcacctcc      1140
     tcacaattta agcagtcgtt cgtcaggata ttcgacaagg atgctaagga taacctactc      1200
     atgggcttca atgcatctct tgaggttctg actaccaagg agctgaaggt caccggcctt      1260
     attggtcacg ccgtttccct gaacaagaag tcgagctctg tcggcgaaac ggaatgcggt      1320
     atcggcaaca cttgcgcatg gaagatgtgt ggtatcgacc ctgcctcgag ctacggcgtc      1380
     tacttcgaaa tagcaaacca gggcggccct gcagcagtgc aaccaggccc tcaaagggga      1440
     atgatgcaat tcctcacata ctaccagcac tcgtcgggtc actaccacct tcgggtcaca      1500
     acggtcgcgc ggcccctcag cggtcctgcg ggcgacccta cgctggcgca gtctttcgat      1560
     caggaagcag ctgccgtgtt gatggcccgt atcgccgtgt tcaaggccga ggtggacgat      1620
     ggccccgatg tgctcagatg ggttgaccgg atgctcatca gactttgctc tcgtttcgcc      1680
     gactaccgga aagatgaccc tacgtcgttc cggttggaga agaacttcac cctctaccct      1740
     cagttcatgt tccacctgcg ccgaagccag ttcttgcagg tgttcaacaa ctcgcctgac      1800
     gagactgctt tctaccggca tgtgctcaac cacgaagatg ttggcgactc tcttgttatg      1860
     attcagccaa ctctggattc ctactccctt gaacacgaag gaagccaacc tgtgctcttg      1920
     gattcggctt ctatccagcc cgctcacatc cttcttctgg acactttctt ccacatcctg      1980
     attttccacg gtgagactat cgcggaatgg aggaaggctg gttaccagga tcaggagggc      2040
     tacgagaacc tgaaggtgct cctcgagcaa ccaaaggaag acgctaggga actgatttcc      2100
     gatcgtttcc cgctgccccg tttcatcgtt tgcgatgctg gtggctccca ggctcgtttc      2160
     cttttgtcta agctgaaccc atctactacc cacacaacag gaggatacgg cggaggtgtg      2220
     acgtcgcaga tcatcttcac tgatgatgtc tcgttgcaga cttttatgga ccatctcatg      2280
     aagcttgctg tttccggaac cagctag                                          2307
//

If you have problems or comments...

PBIL Back to PBIL home page