(data stored in ACNUC7421 zone)

EMBL: AM269963.PE31

AM269963.PE31        Location/Qualifiers
FT   CDS_pept        join(83371..83374,83435..83468,83535..83655,83722..84046,
FT                   84102..84115)
FT                   /locus_tag="An01g04740"
FT                   /note="Remark: the ORF overlaps with A. niger EST an_2410
FT                   in EMBLEST."
FT                   /note="Similarity: ribosomal protein L12 is highly
FT                   conserved."
FT                   /note="Title: strong similarity to ribosomal protein of the
FT                   large subunit L12 - Mus musculus"
FT                   /note="See PMID 8359697"
FT                   /db_xref="GOA:A2Q8L2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L2"
FT                   /inference="profile:COGS:COG0080"
FT                   /inference="profile:PFAM:PF00298"
FT                   /inference="profile:PFAM:PF03946"
FT                   /inference="similar to AA sequence:PIR:JN0778"
FT                   /protein_id="CAK37009.1"
FT                   /translation="MPPKFDPNEVKIIHLRVTGGEVGAQSALAPKIGPLGLSPKKIGED
FT                   IAKNTGDWKGLRVTVRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSI
FT                   PLDEIIEIARKMRHRSLAKELKGTVLEILGTAFSVGCQVDGRSPKDVSDDVKAGEIDIP
FT                   SE"
     atgcctccca agttcgaccc caatgaggtg aagatcatcc acctgagagt gactggtggt        60
     gaggtcggtg cccagtctgc tctggccccc aagattggtc ctctcggtct gtcccccaag       120
     aagatcggtg aagatattgc caagaacact ggtgactgga agggtctccg tgtcaccgtc       180
     cgcctgacca tccagaaccg tcaggccgcg gtctccgttg tgccctccgc ctcttccctg       240
     gtcatcaagg ccctcaagga gcctccccgt gaccgcaaga aggagaagaa catcaagcac       300
     agcaagtcca tccctctgga cgagatcatc gagatcgccc gcaagatgcg ccaccgctct       360
     cttgctaagg agctcaaggg taccgtcctt gagatcctcg gtaccgcttt ctccgtcggt       420
     tgccaggtcg atggccgcag ccccaaggac gtctccgacg acgtcaaggc tggcgagatc       480
     gacatcccct ccgagtaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page