(data stored in ACNUC7421 zone)

EMBL: AM269963.PE33

AM269963.PE33        Location/Qualifiers
FT   CDS_pept        join(89808..91576,91626..92977,93350..94239,94292..94921)
FT                   /locus_tag="An01g04760"
FT                   /note="Similarity: similarity to
FT                   N-acetylglucosaminyltransferase chain p110 from R.
FT                   norvegicus is only over C-terminal region."
FT                   /note="Title: similarity to hypothetical protein B12K8.10
FT                   -Neurospora crassa"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L4"
FT                   /inference="profile:COGS:COG3914"
FT                   /inference="profile:PFAM:PF00515"
FT                   /inference="similar to AA sequence:UniProtKB:NCB12K8.1"
FT                   /protein_id="CAK37011.1"
FT                   /translation="MLPSVAPFPPVQPHHLSYRHGADATNGPYDRNTSFLTSLPRSDFG
FT                   KDSFQSVARSRLQYPHPIQRLEVPDATGLVPSPKSAGEHALRRKTPNGTLAAGYDGTPG
FT                   DTTIQPASKHLLVSPIDSGHLIPPHTGFPVETWQQANLDQSSAGKHMNFPPVYRNDSSR
FT                   TNAGPAELTQGMNGTSWVRSLNYVPGMDSMLNQSLPMQPSQQRFYWHNGAYVPTVLPAT
FT                   LQPCVGPTASAGTGPYGPYWPDGVYIPYRPAAFRDARFDSPTPFAKATNPPALQLFDAG
FT                   QQPFSRGALSSGSHPDPGLAWNQAPAGMVNSELSMKNNFPRRHSEQKVAGLPGGQRTLP
FT                   YHTRQSNPTPGFSHQQVHDTGPSWSGPPNTQGVQLGSTASPQATNVEFKEKVLTWAHGV
FT                   YVDLLASIHQARRNSISTAAAEGQSQRFLKPSIYPKPPRQPGLDFSNTNTLESTRHNNY
FT                   SSGQHDLVQRNNTIGNIGHNDTASFQAGRRYERASLSQFPQAATDVQMLDRLRHTGRFT
FT                   ASTATSRFGAAPLNEGSITANAVSSLEMLSHLCAESGWEWIDGMLLGGCLAYGLGDYHK
FT                   AMRWYTRIIARDATHVEAISNLAATLLALDRRDEALQHWLRAVKLRPSFFEAVEHLIGL
FT                   LCSSQRGKEAVNIIEFVQNSIRSPKNGDCFASDEHASEPESDAESRASSASDLGSYEKA
FT                   SFDYDDDFGRSVATNRGSADVGSAGFGSSGYAIPGCDNGRMLALVHAKGNMLYALGDNA
FT                   AAAVAFEDAILIAAGRRRHGIQSLIKQIFSAFMQGTHHGYPGPEQREQQETILLYPDHA
FT                   LQTAKLVFAPCGTPPGIKYVPEGLARKAAISTTSNSLLSLAKIYQDGMSNISSSGVPRS
FT                   APGVRDILALYYLSLSLQPSPSTANNVGILLAGIQNNAPKKVLPRPSGEMQHPEIPGVI
FT                   PGTGISLALAYYNYGLHLDSRHAHLYTNLGSLLKDIGQLQAAIRMYEQAVHCDSNFDIA
FT                   LANLANAVKDAGRVNDAIVYYKRAVKVNPEFAEAVCGLANALNSVCNWVGREYPLTKYR
FT                   RPQLPSGLTAPNAPTVLPFHTFTCPLSAKQIRQISQRNGLRISCSTLRSPWLPATVFPP
FT                   PPPPHPYIKVGYVSSDFNNHPLAHLMQSVFGLHNPSRVKAYCYATTVSDKSIHRQQIEK
FT                   EAPVFHDASGWPVDRLVRQIVEDGIHILINLNGYTRGARNEVFAARPAPIHMSFMGFAG
FT                   TLGAEWCDYILADELSIPPETLSPGRRNIRMEDRLLEEDHGEDLENWVYGEKIVYTRDT
FT                   FFCCDHRQSAPDAQDPRLAWDQEQARRWRMRKELFPNLSDDTIILGNFNQLYKIEPTTF
FT                   RTWLRILARIPNAVLWLLRFPDLGEQNLRETAVAWAGEETASRIIFTDVAPKNTHISRA
FT                   KILDLFLDTPECNAHTTATDVLWSGTPLLTLPRYKYKMCSRMASSILSSALPKSDAGRE
FT                   AQSDLIAMSDEDYENKAIRLCLSLKYQPGGQGHATGRLADLRRMLFEERWSSRLFDTKR
FT                   WVRDLEDAYERVWQRWVNGEEGDIWL"
     atgttgccct cagtagcacc gttcccgcca gtccagccgc accaccttag ttatcggcac        60
     ggtgccgacg ctacaaacgg gccttacgac cgcaacacat catttctcac gtcactaccc       120
     cgcagcgatt tcggcaaaga ctcgttccag tccgtagctc gatctcggct gcaatatccg       180
     catcctattc aacgcctcga ggtacctgat gccacgggtc tggtacctag cccgaagagt       240
     gctggcgagc atgcattacg aaggaaaaca ccgaacggga cactggcggc tgggtatgat       300
     ggcacaccag gggataccac cattcagccc gcgagcaagc acctcttggt ctcgccgatc       360
     gattcgggcc acctgatacc gccccataca gggttcccag tggagacatg gcaacaggcc       420
     aatttggatc agtcttcagc cgggaagcac atgaatttcc cgcccgtata tcgaaatgat       480
     tcgagccgaa ctaatgcagg tccagcagag ttgacccaag gaatgaatgg caccagttgg       540
     gttcgttcat tgaactatgt tccaggaatg gactccatgc tgaatcagtc gctaccaatg       600
     cagccttccc agcagcgatt ttactggcac aatggtgcct atgttcctac agttctacca       660
     gcgacactcc agccctgtgt cggtcctacc gcgtcggcag gaacgggacc atatggtcca       720
     tattggcccg atggagtgta tatcccgtat cgcccagcgg cgtttcggga tgcccgattc       780
     gactcgccca ctccttttgc aaaggcgaca aacccacccg cccttcaatt attcgacgca       840
     ggccaacagc ccttcagtcg gggcgcttta tcttcaggca gtcatcccga cccgggcctg       900
     gcgtggaatc aggcccctgc tggaatggtc aactctgagt tgtccatgaa gaataacttt       960
     cctcggcgtc attcggagca gaaagtcgct ggtctgccgg gcggccagcg gacactgccg      1020
     taccatacgc gccagtctaa tcctacccct ggcttttcgc atcagcaggt ccacgacaca      1080
     ggcccgtcat ggtcaggtcc tccaaatacc caaggggtcc aactgggctc tacggcaagc      1140
     ccacaggcaa cgaacgtgga gttcaaggag aaggtgctga catgggctca tggtgtttac      1200
     gttgacctac tggcatccat ccaccaagca cgacggaata gcatctcgac cgcggctgct      1260
     gagggacaga gtcagcgttt tctgaaaccg agtatatacc cgaaaccacc gcgtcagcct      1320
     ggtcttgatt tttccaacac taatacgctg gaatcgactc gtcacaataa ctactcttcg      1380
     ggccagcatg atcttgttca gaggaacaac accattggca acataggcca caatgatact      1440
     gccagcttcc aggctggccg tcggtatgaa cgtgcttcac tgtctcagtt cccgcaagct      1500
     gcaaccgatg tacagatgct cgacaggctc cgccacactg gacggtttac tgcatccacg      1560
     gcaacgtctc gtttcggtgc cgcaccgttg aacgagggtt ctataacagc gaatgctgtt      1620
     tcatctttgg agatgctatc ccatctctgc gcggagagcg gttgggaatg gattgatggg      1680
     atgcttcttg gaggctgtct cgcttatggg cttggagatt accataaggc catgcgttgg      1740
     tatactagaa tcatcgctcg agatgcaacg catgtggaag cgatatccaa tcttgcggcc      1800
     acccttctgg cgctggatcg ccgagatgag gccctgcaac attggcttcg tgccgttaag      1860
     ctccgcccga gtttctttga ggcggtagag cacctgatcg gtcttttgtg cagcagccaa      1920
     cgtggcaagg aagcagtcaa catcattgag ttcgtgcaga attccatacg ctcccctaag      1980
     aacggcgatt gtttcgcgtc cgacgaacac gcgagtgaac ctgagagcga cgcggagagc      2040
     agagcgtcga gtgcgtccga tttgggttcc tatgagaaag cgtcctttga ttacgatgac      2100
     gactttggtc ggtcagttgc cacaaatcgg ggctcggcag atgttggctc ggctggattt      2160
     ggttccagcg gctacgccat acctggctgt gataatggca gaatgctggc tctcgtccac      2220
     gcaaagggaa atatgctata tgccctaggt gacaatgctg cagctgccgt agcctttgag      2280
     gatgctattc tgattgcagc tggaaggagg cgtcatggta tacaaagcct gatcaagcag      2340
     atattctcgg ccttcatgca gggtacgcat cacggctacc ccggcccaga gcaacgtgag      2400
     caacaggaga ccattctcct gtatccagac catgctctgc aaaccgcaaa gttggtcttt      2460
     gctccctgcg gaacaccccc ggggatcaaa tatgtgccgg aaggtctggc aagaaaggcc      2520
     gctatatcta ctaccagcaa ctcgttgctc tctctggcca agatatacca agacggcatg      2580
     tctaatatct ccagctccgg cgttccaaga tctgctccgg gcgttcggga tattctagca      2640
     ctctattatc tttccctttc tcttcagcca agtccatcca ccgcaaataa tgtgggtatc      2700
     ttgctggctg gtattcagaa caatgccccc aagaaagttc taccacgtcc aagcggagag      2760
     atgcagcatc ctgaaatacc cggtgtaatt cctggcacgg gaatatcgtt agctctcgcg      2820
     tattacaact acggtctaca cctcgattcg cgacatgccc atctttacac aaatcttgga      2880
     agcctgctca aggatattgg ccagttgcaa gcggctatcc gaatgtatga acaggccgtt      2940
     cattgcgata gtaactttga cattgcgctg gcgaacctgg cgaacgcagt caaagatgcc      3000
     ggtcgcgtta acgatgctat cgtctattac aagcgtgccg tcaaagtgaa tccggaattt      3060
     gctgaggcag tgtgtggcct agccaacgct ctcaattctg tctgcaactg ggttggccgc      3120
     gaataccctc tgaccaagta tcggcgaccg cagcttccct ctggcctgac ggcgccaaat      3180
     gcgccgacag tcctgccttt ccataccttc acctgcccgc tgtcagcgaa gcagatccgg      3240
     caaatttcgc agcggaatgg gcttcgtatc tcttgttcca ccttgcgttc gccgtggctg      3300
     cctgctactg ttttccctcc gcctccccca ccgcaccctt acatcaaggt cgggtacgtg      3360
     tcatcagact tcaacaacca cccgctggcc catctgatgc agtccgtctt tggactgcac      3420
     aatccttctc gggtgaaagc atactgttac gctacgaccg tgagcgacaa gtcgatccat      3480
     cgccaacaga tcgagaaaga agcgccggta tttcacgatg ctagtggatg gcccgtcgat      3540
     cgactcgtca gacaaattgt ggaagacgga atccatatcc tcatcaacct gaatgggtac      3600
     acccgtggtg cccggaatga ggtctttgct gctaggcccg ctccaatcca catgtctttc      3660
     atgggctttg cggggactct tggggcggaa tggtgcgatt acatccttgc ggacgagctc      3720
     tctattcccc ccgagaccct ttcccctgga cggcgcaaca tacggatgga ggatcggcta      3780
     ctcgaagaag accacggtga ggatcttgag aactgggtgt acggcgagaa gattgtttat      3840
     actcgcgaca ccttcttctg ctgtgaccat cggcaaagtg ctccggatgc tcaagatcct      3900
     cgcctggctt gggatcagga gcaggcccga cggtggcgca tgcgtaagga actgtttcca      3960
     aatctgagcg atgacaccat catacttggg aatttcaacc agttgtacaa gattgaaccc      4020
     acgactttcc gcacttggct acgcatcctg gcacggatcc ctaatgccgt cctctggctc      4080
     ctccgctttc ccgacctcgg tgaacagaac cttcgtgaga cagccgttgc ctgggctggg      4140
     gaggaaacag catctcggat catcttcacc gacgttgcac ccaagaacac gcacatctcg      4200
     cgagcaaaga tcctggatct gttcctcgac acgccagaat gcaatgctca tacgacagcg      4260
     accgatgtgt tatggagtgg cacgcccctc ttgaccctgc ctcggtacaa gtacaaaatg      4320
     tgctcgcgta tggcaagcag cattctgagc agtgctctgc cgaagtctga cgcaggccgc      4380
     gaggctcagt cggacttgat cgccatgtcg gacgaagact atgagaataa ggccattcgc      4440
     ctgtgtctca gtctgaagta ccagcctggt ggacaaggtc atgcgacggg caggttagcc      4500
     gacctgcgcc ggatgctgtt cgaggagcgg tggtccagca ggcttttcga tacgaagcgt      4560
     tgggttcgtg atcttgagga cgcctacgaa cgagtttggc aaagatgggt gaatggcgaa      4620
     gaaggcgata tctggttatg a                                                4641
//

If you have problems or comments...

PBIL Back to PBIL home page