(data stored in ACNUC7421 zone)

EMBL: AM269963.PE35

AM269963.PE35        Location/Qualifiers
FT   CDS_pept        complement(join(98181..98246,98418..98504,98612..98774,
FT                   98868..98912,99029..99100,99196..99260))
FT                   /locus_tag="An01g04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8L6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L6"
FT                   /protein_id="CAK37013.1"
FT                   /translation="MEYLLHRICPASFPGLVAFTTNRAKYASGVDHTAPNETIDGKRMA
FT                   HGLASSNATKKCSKDSPSQSVSVIFNRSSICELGMYLLRSYTDVSQLDRCRLLPYYLST
FT                   QLQALVRNQYAPSSTYLNETPNTFAVSLALDIIRQAPLAENETEGYCDHSMVMSNRLIW
FT                   VV"
     atggagtacc ttctacatcg gatatgccca gcatcttttc cgggacttgt ggctttcact        60
     accaaccgtg ccaagtacgc ttccggggtc gatcatacag cacctaatga aacaatagat       120
     gggaaaagaa tggcccatgg tctagcttca tccaatgcga ctaagaaatg cagcaaagac       180
     agtccaagcc agtctgtctc cgtaatattc aacagatcga gtatatgtga gttgggaatg       240
     tatctgctca gaagttatac ggatgtatct caactcgatc gttgccggct tctcccttac       300
     tatctctcta cacagctgca ggcgcttgtc agaaaccagt acgccccatc atctacctat       360
     ctaaatgaaa caccaaacac atttgctgtt tctcttgctc ttgacatcat tagacaggcg       420
     cccttggccg agaacgagac tgaggggtat tgtgaccata gtatggtgat gagcaatcgt       480
     ttaatctggg tggtgtag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page