(data stored in ACNUC7421 zone)

EMBL: AM269963.PE36

AM269963.PE36        Location/Qualifiers
FT   CDS_pept        join(99856..99971,100134..100325,100404..100611)
FT                   /locus_tag="An01g04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8L7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L7"
FT                   /protein_id="CAK37014.1"
FT                   /translation="MSCSRSFNKSCENMGSCYNAFNNQGSLGPEACTWGFSLWLVCWTT
FT                   CLPLYLTNFLRCQSWIVVDVPSTEPRYCVCGACRTEGEWAVSTHVQDQLPWEMDNRVDA
FT                   DWLFDGYVDEDGAFLVCSPHKTPSLAYAEYKKWIMIFLQTRFCRARVERPRELVRLVVA
FT                   ELAARKYW"
     atgtcgtgct ctaggtcatt caacaagtca tgcgaaaata tggggagctg ctacaatgct        60
     ttcaacaatc aaggtagctt agggcccgag gcatgtacct ggggattttc tctgtggctt       120
     gtatgttgga cgacatgtct tcctttgtat ctcacgaatt tcctcagatg ccaatcatgg       180
     atcgtggtag acgtgccctc gaccgagccg agatactgtg tctgtggagc gtgtaggacg       240
     gagggagaat gggccgtatc gacgcatgtg caggatcagc tgccatggga gatggataac       300
     cgcgtggatg cggattggct ctttgacgga tatgtagatg aggacggcgc tttcctggta       360
     tgctcacccc ataagactcc ttcacttgca tatgcggagt ataagaaatg gatcatgatt       420
     ttcttgcaaa cgaggttttg cagagcaaga gttgaacgac ctagagaact tgtccgatta       480
     gtggttgcag agctagctgc taggaaatac tggtag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page