(data stored in ACNUC7421 zone)

EMBL: AM269963.PE37

AM269963.PE37        Location/Qualifiers
FT   CDS_pept        join(101804..101938,102052..102204,102625..102676,
FT                   102763..102854)
FT                   /locus_tag="An01g04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8L8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L8"
FT                   /protein_id="CAK37015.1"
FT                   /translation="MDSIVWDKNPVASHAASNGEFQIRMPCCKGAVYNPRAGIVTTVEP
FT                   VIPTSLASGGMGDGERGWDGCVARDRGPFLLAFGVYHRWLVGLSVKQAGRDDPGSSSFL
FT                   LRSLATICRSWIVRPLDSDNLVGQLSSVLSVAPHAANIS"
     atggatagca tcgtgtggga caagaacccg gtggcatcac atgcagcctc caacggagaa        60
     ttccaaatcc gcatgccttg ctgcaaaggt gcggtttaca acccgcgtgc agggatagta       120
     acgaccgtcg agccagtaat ccccactagt ttagctagcg gagggatggg ggatggggaa       180
     cggggatggg atggttgcgt ggctcgggat cggggacctt ttctcctcgc cttcggggtt       240
     tatcatcgtt ggttagttgg gttatccgtc aaacaggctg gtcgtgatga tcccggttcg       300
     tcttccttcc ttcttcgttc cctcgcgacg atctgtcgta gctggatcgt gcgccccctc       360
     gactctgaca acttggttgg tcaactatcc tccgtactat cggtggctcc tcatgcagcc       420
     aatatctcct ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page