(data stored in ACNUC7421 zone)

EMBL: AM269963.PE39

AM269963.PE39        Location/Qualifiers
FT   CDS_pept        complement(112254..113183)
FT                   /locus_tag="An01g04830"
FT                   /note="Function: the flbD gene from Aspergillus nidulans
FT                   encodes a protein with a Myb-like DNA-binding domain that
FT                   is proposed to act in concert with other developmental
FT                   regulators to control initiation of conidiophore
FT                   development."
FT                   /note="Function: the flbD gene from Aspergillus nidulans is
FT                   involved in the coordination of initiation of conidiophore
FT                   development."
FT                   /note="Title: strong similarity to myb-like DNA binding
FT                   protein flbD - Aspergillus nidulans"
FT                   /note="nucleus"
FT                   /note="See PMID 7883170"
FT                   /note="See PMID 9539422"
FT                   /db_xref="GOA:A2Q8M0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M0"
FT                   /inference="profile:COGS:COG5147"
FT                   /inference="profile:PFAM:PF00249"
FT                   /inference="similar to AA sequence:UniProtKB:EN19882.1"
FT                   /protein_id="CAK37017.1"
FT                   /translation="MAPTHRRGPWVPEEDQLLLQLVREQGPNNWVRISQHMHYRSPKQC
FT                   RERFHQNLKPSLNREPISAEEGLMIERMVNEMGKRWAEIARRLGNRSDNAVKNWWNGSM
FT                   NRKRRGLPTSSSPHAGRTMHGRVEAPYARASLSMSSPISRSRYSSISNDRPLTSWTKSP
FT                   SSRRDSFSAASIDCPRQLTPIYTLPALNRPVETPLTSPAFSEASSMEPPSMISDHNSVS
FT                   SSSPRTIASPQLLPLPVDMRQQYGDFRRQSTSDDIYAYHDLSLKQRWISDHQQWNQHSP
FT                   LSPTWSAPIEDKTEAPRDSRMGLQNLLN"
     atggctccca ctcatcgtcg tggaccctgg gttcctgaag aggaccagtt gctccttcag        60
     ttggttcgcg aacaaggccc caacaactgg gttcgcatct ctcagcacat gcactaccgc       120
     tcgcccaagc aatgccgcga gcgcttccac cagaacctca agccctcttt gaaccgtgag       180
     cccatctctg ctgaagaggg cttgatgatc gagcggatgg tgaacgaaat gggcaagcgc       240
     tgggccgaga ttgcacgacg ccttggaaac cgcagcgaca atgcggttaa gaactggtgg       300
     aacggcagca tgaaccgcaa gagaagaggt ctccctacct ccagctcgcc tcacgccgga       360
     cgcacaatgc acggacgggt cgaggcccca tatgcgcggg cctctctgtc catgagcagc       420
     cccatcagcc gctctcgcta ctcttccatc tccaacgaca gacctctgac ttcctggacc       480
     aagtctccct catctcggag ggattccttc tccgccgctt ccatcgactg cccccgccag       540
     ttgaccccga tctacacact tcctgctctt aaccgcccag tggaaactcc tctcacatcg       600
     cctgccttct ccgaagcttc ttccatggaa cctccctcga tgatctcgga ccacaactcc       660
     gtttcttcct cctctcccag gaccatcgcc tcgccacagc ttcttcccct tccggtggac       720
     atgagacagc aatacggcga cttccgcagg cagagcactt cggacgatat ctacgcctat       780
     cacgatctgt cgttgaagca acggtggatc tccgatcacc agcaatggaa ccagcactct       840
     ccgctatctc ccacatggtc tgctccgatc gaagacaaga cagaagctcc gcgcgactcg       900
     cggatgggtc ttcagaactt gctcaactaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page