(data stored in ACNUC7421 zone)

EMBL: AM269963.PE8

AM269963.PE8         Location/Qualifiers
FT   CDS_pept        complement(join(21152..21371,21654..21806,21879..21961))
FT                   /locus_tag="An01g04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8I9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I9"
FT                   /protein_id="CAK36986.1"
FT                   /translation="MGGVNHVAWVKGKGRLPALLRAVMWQQKSFQGPLVARRPGMPSCW
FT                   AYRDDGDDVTQASSKLIYLVKYGNSDYHSSRHLGPGAKGWAKFPLWWTDYCYHHLIAVA
FT                   GPHAPTSAVSCSTATSAVNWISFPSLPRVLERLVPARLVSRARITRK"
     atggggggtg taaaccatgt tgcttgggta aaggggaagg ggagattgcc agccttgctg        60
     agggctgtaa tgtggcaaca aaagagtttc caaggtccgt tagtcgcccg gagacctggg       120
     atgccttcct gctgggctta tcgggatgat ggtgatgatg taactcaggc cagctccaag       180
     ttgatctacc tcgtaaagta cgggaatagt gactatcatt cctccaggca cttgggacca       240
     ggcgctaagg gttgggccaa gttcccgctc tggtggacgg attactgtta tcatcacctc       300
     atcgccgtag ctggaccaca tgcgcccacc tctgctgttt cctgcagcac agcgacaagc       360
     gccgttaact ggatatcatt cccctctctc ccgcgcgttc ttgaacggct tgtcccggca       420
     agactggtct cgcgggccag gatcacacgg aagtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page