(data stored in ACNUC7421 zone)

EMBL: AM269964.PE1

AM269964.PE1         Location/Qualifiers
FT   CDS_pept        complement(join(300..525,838..1151,1314..1394))
FT                   /locus_tag="An01g04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8M1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M1"
FT                   /protein_id="CAK37018.1"
FT                   /translation="MNRGDGTAVPCLWCRGIQIEWASEHLCPVAPARRYSGPDSRLRMI
FT                   PMSIPTLPGMRQSQKIPNLQRALAGSAPITAPTQTVHVLGNGPRGVEEGSSLRPVRMRV
FT                   SGGQWALPAKGEAKSSRVTNRSIGVLTTRRGGGGGAGACPRSRYTLTPLCNHSEVLFVI
FT                   FPHLSQIGNLLPCPLLSLSLFFSFFLPFLPSIRISNSEVARPA"
     atgaaccgag gagacgggac agcggtcccg tgtctctggt gcagagggat tcagatcgag        60
     tgggctagtg agcatctgtg tccggtagca ccggcgcgaa ggtactccgg cccagattcg       120
     agattgcgta tgatccccat gtcgatccca accctcccgg gtatgagaca aagccaaaag       180
     attccaaatc ttcaaagggc gctagccggc tctgcaccaa tcactgcccc cactcaaacg       240
     gttcatgttc tgggtaacgg cccacgggga gtggaggagg gatcaagcct gcgtccggtg       300
     cggatgaggg ttagcggcgg ccaatgggcg ctaccagcca agggtgaggc caaaagtagc       360
     agggttacaa atcgctccat tggagtgcta actacgagga gggggggtgg tggtggtgcg       420
     ggcgcctgtc cacgatctcg gtacacctta acgccattat gcaaccactc ggaggtgctc       480
     tttgtcattt ttccgcatct ttctcaaatc ggcaatctac ttccctgtcc cctgctctct       540
     ctctctctct ttttctcttt tttcctgcct ttcctcccct ccatcagaat ttctaattcc       600
     gaggttgccc gccccgcctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page