(data stored in ACNUC7421 zone)

EMBL: AM269964.PE10

AM269964.PE10        Location/Qualifiers
FT   CDS_pept        join(19872..20003,20080..20102,20195..20325,20436..20524,
FT                   20589..20678,20734..20766)
FT                   /locus_tag="An01g04930"
FT                   /EC_number="3.6.3.14"
FT                   /note="Catalytic activity: S. cerevisiae ATP Synthase delta
FT                   chain produces ATP from ADP in the presence of a proton
FT                   gradient."
FT                   /note="Complex: S. cerevisiae ATP Synthase delta chain is
FT                   part of the catlytic heteromeric complex ATP-synthase."
FT                   /note="Function: S. cerevisiae ATP Synthase delta chain is
FT                   involved in ATP synthesis."
FT                   /note="Remark: the systematic name for ATP16 of S.
FT                   cerevisiae is YDL004W."
FT                   /note="Title: strong similarity to ATP synthase delta chain
FT                   Atp16 - Saccharomyces cerevisiae"
FT                   /note="localisation:mitochondrion"
FT                   /note="See PMID 8026496"
FT                   /db_xref="GOA:A2Q8N0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N0"
FT                   /inference="profile:COGS:COG0355"
FT                   /inference="profile:PFAM:PF02823"
FT                   /inference="similar to AA sequence:PIR:S45632"
FT                   /protein_id="CAK37027.1"
FT                   /translation="MSSLRFARSAFRARPSALRVPLQRRGYAEAVSDKIKLSLTLPHQS
FT                   IFKSTGVVQVNIPAESGEMGVLANHVPSIEQLKPGLVEIVEEGGASKKFFLSGGFAVVQ
FT                   PDSQLSINAVEGFPLEEFSIDNVRSQIAEAQKIANGSGSEQDIAEAKIELEVLESLQAV
FT                   LK"
     atgagctctc tccgcttcgc tcgctctgcc ttcagggccc gtccctccgc tctccgcgtt        60
     cctctccagc gcagaggtta cgccgaggct gtgtcggaca agatcaagct ttccctgacc       120
     cttcctcacc agtctatctt caagtcgacc ggcgttgtcc aggtcaacat ccccgccgaa       180
     tccggagaga tgggtgttct cgccaaccac gtcccctcca ttgagcagct caagcccggt       240
     ctcgttgaga tcgttgagga gggtggtgcc agcaagaagt tcttcctgtc tggtggtttc       300
     gccgttgtcc agcccgactc ccagctgagc atcaacgccg tcgagggttt ccctctcgag       360
     gaattcagca ttgacaacgt ccgttcccag atcgccgagg cccagaagat tgccaacgga       420
     agcggcagcg agcaggatat tgctgaggcc aagattgagc ttgaggtgct ggagagcctg       480
     caggccgtcc tcaaatag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page