(data stored in ACNUC7421 zone)

EMBL: AM269964.PE11

AM269964.PE11        Location/Qualifiers
FT   CDS_pept        21100..22485
FT                   /locus_tag="An01g04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8N1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N1"
FT                   /protein_id="CAK37028.1"
FT                   /translation="MPSAFTKPVAIMQEPKSSDLEYPFCEGSDNPQNSSSQLQYKHPDD
FT                   CPARPIMTRSDTHDTDAFHIFPMDVDKEHSKNPSTSEYKMMGALFNKDTANRQGLPDLS
FT                   NDSVVLENWYESTTGPCSTLDRGTPSLARPENTTLVILNEKSLSERNSRGPVEAKSAWK
FT                   PPRPPKPRFLAHLDVAGFESYENSTPCPMPASRDGPGGHKWLAPRLLQGMDNDISKRRK
FT                   PWSDPKLGPSRYLSRPAKRGAKSYLTKNDLSQPFPGPWPSIDGLLLRQDSRIAKSSPAK
FT                   ICVRDHSNALSSPQEARESNVKRIGNWLGKLLSWVSHLSKLKERGVISISLVGQRSLQH
FT                   PRFGFASYEYSVSFKWSNTSGSIAIHQGQEEINLPAASKNATRLFRADITVPYLAMRIL
FT                   MGFCAVCRSRMSRGVMISFVRLFMRLIGLPVLYFLERLSVSLSIHPRESNTTQSARDQH
FT                   AVF"
     atgccgtctg cgttcaccaa gccagttgca atcatgcagg agcccaagtc cagtgacctg        60
     gaatatccct tctgtgaagg ctcggacaat ccccaaaact cttcgagtca actccagtat       120
     aaacatccag atgactgtcc tgcccgcccg atcatgaccc gcagcgatac tcatgatact       180
     gatgctttcc acatatttcc aatggacgtg gataaagaac actcgaaaaa cccttcaacc       240
     tcagaataca agatgatggg agctctcttt aataaggaca cggcgaaccg ccaaggattg       300
     cccgatctat ccaatgattc agttgtgctt gaaaattggt atgagagcac aaccggacct       360
     tgcagcacat tagaccgagg gactccgtct ctagcgagac cggaaaacac aaccctcgtt       420
     atactgaacg agaaaagctt atctgaacgc aatagtcgcg gtcctgtgga ggccaaatca       480
     gcgtggaaac cgcctagacc ccctaaacca cggttcctag cacaccttga cgttgccggc       540
     ttcgagtcat atgagaattc aacaccgtgc ccaatgcctg cctcgagaga cggccctggg       600
     ggtcacaaat ggctggcacc tagattgctg caaggtatgg acaatgatat cagcaagcga       660
     cggaaaccat ggagcgaccc caagctcggc ccatctcgat atctatcccg gcctgccaaa       720
     cgtggcgcaa agtcttacct caccaagaac gatctgagcc agccgttccc cggcccctgg       780
     ccttcaattg atggcttgct attgcgccaa gattcaagga ttgctaagtc gagccctgcc       840
     aagatatgcg tccgggacca cagtaacgcc ttgtcaagcc cccaagaggc acgagagtca       900
     aatgtgaagc gcataggcaa ctggcttggg aagctactta gctgggtttc gcacttatcg       960
     aagcttaagg aacgaggcgt tattagtata tccttggttg ggcagcgatc acttcagcac      1020
     ccacgtttcg gatttgcatc ctacgaatac agtgtgagct tcaaatggtc aaatacgtcg      1080
     gggtctattg caatacatca aggacaagaa gagatcaacc tacctgctgc gtcaaaaaat      1140
     gccacccgtc tcttccgggc tgatattaca gtaccgtatc tcgctatgcg gattctcatg      1200
     ggcttttgtg ccgtctgccg gagccgtatg tccagaggag tcatgattag ctttgtgcga      1260
     ctcttcatga gactcatcgg acttccggtt ctgtattttt tagagagatt gagcgtcagc      1320
     ttgtccattc acccaaggga gtctaacacg acccagagcg caagagatca acatgcggtt      1380
     ttttga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page