(data stored in ACNUC7421 zone)

EMBL: AM269964.PE12

AM269964.PE12        Location/Qualifiers
FT   CDS_pept        complement(join(23105..24955,25010..25377,25428..25578))
FT                   /locus_tag="An01g04950"
FT                   /note="Similarity: similarity is from the N-terminal region
FT                   of the predicted A. niger protein to A. thaliana At2g30890
FT                   , which is 500aa shorter."
FT                   /note="Title: weak similarity to hypothetical protein
FT                   At2g30890 - Arabidopsis thaliana"
FT                   /db_xref="GOA:A2Q8N2"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="InterPro:IPR007128"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N2"
FT                   /inference="similar to AA sequence:PIR:H84713"
FT                   /protein_id="CAK37029.1"
FT                   /translation="MTADSGLSAAGSSTYASNTLHVGDGTWDSERDTYLLPNLMGINFD
FT                   TMRYNGMGNRFKDMPEYHTLIVVHGVIATIVFLFLVPISVLIIRYYSRWNPFWAFKLHV
FT                   WCQVLTLLLSTVVFVFGWFAVGPKRSLTNPHHGIGLAIYVLVIFQILWGWLVHKIERNR
FT                   RSYHVPLKLVIHRWIGRALAILGLVQIPLGLTLYGSPKVLFILYAVVAFILLAVFFVLS
FT                   YLYDTEGYHMESGGYESRLSYVSGPSAADDHGHSNLGPMAAAGATGAGLASLFRRRSRG
FT                   RPHDYDESHTSFSDEKLSDEGPRRGGKGNLLLKLGAIGGGAWLAKKFFDRRRERDNDTE
FT                   SGRYSRAHTRSDSMTEESLSRLEDGRRPEPTAHTPLNRPPSRPPSRPPSRPPSRPPSRP
FT                   LSRPQSPGSSYLYNSTYLSEAPPRRPSHGLRDALLGAGALAAIKGFFSRRKGDAEQRRV
FT                   EEMRRREMEDERLARANSKRRYPGEGYYPRRDRPASFTATDLSTDLSRPPRGPPHGESI
FT                   VSAAGPPMASGAVDGARSDIPPAPGPPVPPPAASEYPGPAASTHGPTELASGVAAGTAL
FT                   GAASSAHRRRSASRHRSSSRPRSSSRHRDPIASPPVSVKLKMHNDGRHVTLRRLTDEEA
FT                   AASREARRRERRNSRRRAGSASSLSGNEGGSYDRWRRVEELERQQQEQMQREQAAAAAA
FT                   SSGFPATSAAPSSSMPPATSAYYAPPPQNGNGSHMPPPPPPPVPSSHPYGTGSIASPGT
FT                   FTGTEASGDYASNRRRRRAERARARQERQQHGVEFT"
     atgacggccg actctggcct ctccgctgcg gggagcagta cctacgcttc aaatacactg        60
     catgtcggcg atggaacgtg ggactcggag cgcgacacat atctcctccc taatctgatg       120
     ggtatcaact tcgacacaat gcgatacaat ggaatgggaa atcgattcaa agatatgccc       180
     gaataccata ccctcatagt cgttcacggc gtcatcgcta caatcgtctt cctttttctc       240
     gtcccaatct ctgtcttgat catccgatac tactctcgat ggaatccttt ctgggccttc       300
     aagctgcatg tctggtgcca ggtcctgaca ttgttgctga gcaccgtcgt gttcgtgttc       360
     ggttggttcg ctgtcggtcc aaagagaagc ctgacaaacc cgcatcacgg tatcggactt       420
     gcgatatatg tcctagtgat ctttcagatt ctgtggggct ggcttgtcca taagattgag       480
     aggaacagga ggagttacca tgttcccttg aagcttgtga ttcatcgatg gattggacgc       540
     gccctcgcca tcctaggtct tgttcagata ccattggggc tcacccttta tggctcgcct       600
     aaagtgctat ttatcctcta cgctgttgtc gccttcatcc tcctcgcagt gttctttgtg       660
     ctgtcatatc tatacgacac agaaggatat cacatggaga gcggcggata cgaaagccga       720
     ctcagctatg tctcagggcc ctcggctgcc gatgatcatg gtcatagtaa cctcggaccc       780
     atggctgccg caggagcgac cggagctggc ctggcttcgc tcttcagacg tcgttccaga       840
     ggcagaccac acgattatga cgaatcgcat accagtttct cagatgaaaa gctttctgat       900
     gaaggaccac ggcgtggtgg caaagggaac ttacttctga aattaggtgc aattggcggt       960
     ggtgcctggc tcgcgaagaa attctttgac agaagacgcg aacgagacaa cgacacggag      1020
     tccggtcgat acagtagagc tcatactcgg agcgacagca tgaccgaaga aagcttgagt      1080
     agactggaag atgggcggcg acccgagcca acagcgcata ctcctctcaa ccgtccacca      1140
     agcagacctc caagcagacc tcccagcaga cctcccagca gaccaccaag tcgacctcta      1200
     agccgtcctc aaagcccagg ctcttcgtac ctgtacaaca gcacctatct ttccgaagct      1260
     ccccctcgca ggccatccca cggacttcga gacgctcttc tcggagcggg ggcacttgca      1320
     gcgatcaagg gcttcttctc gcgtcgcaag ggcgacgcag aacaacgtcg cgtggaagag      1380
     atgcgccgtc gggagatgga agacgagcgg ctagcccggg ccaacagcaa gcggcgctac      1440
     cccggagagg gctattaccc aagacgtgac cgaccggcat cattcacagc cacggacctt      1500
     tcaacagacc tgtcccggcc accccgcggt ccgccgcacg gcgagtccat agtctcagca      1560
     gcgggacccc caatggcatc cggagcagtg gacggtgcac gctcagacat accgcctgca      1620
     ccagggccac ccgttccccc accagcagca tcggaatacc caggaccagc agcatctaca      1680
     cacggtccta cagagctcgc ctcaggagta gcagccggaa cagccctagg tgctgcgtca      1740
     tcggcacatc gccgtcgcag cgccagccgt caccgaagca gcagccggcc caggagtagc      1800
     agccgtcacc gcgatcccat cgcatctccc cccgtttctg tcaaactgaa aatgcacaac      1860
     gacggccgcc acgttactct ccggagacta acggatgaag aagctgccgc cagtcgcgaa      1920
     gcgagacgaa gagagcgaag gaattcccgt cgtcgcgccg gcagtgcaag ctcgctatca      1980
     ggaaacgaag ggggctcgta tgaccgctgg cgccgtgttg aggagctgga gcgccagcaa      2040
     caggaacaga tgcaacgaga acaggctgcg gcggcggcgg cttcctcggg cttcccagcg      2100
     acttctgctg ctccatcatc aagtatgcct cccgccacgt ccgcctacta tgcaccacct      2160
     cctcagaacg gaaacgggag tcatatgccg ccgcccccgc cgcccccggt gccatctagc      2220
     catccttatg ggacagggag tatcgcgtct ccgggtacat ttactgggac ggaagcgagc      2280
     ggggactatg cgagcaatcg tcgacgaaga cgagcggaga gagctcgagc acgtcaggaa      2340
     agacaacagc atggtgtgga atttacttga                                       2370
//

If you have problems or comments...

PBIL Back to PBIL home page