(data stored in ACNUC7421 zone)

EMBL: AM269964.PE13

AM269964.PE13        Location/Qualifiers
FT   CDS_pept        join(25864..25932,26097..26256,26339..26592)
FT                   /locus_tag="An01g04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8N3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N3"
FT                   /protein_id="CAK37030.1"
FT                   /translation="MEGGGGLGSMGNRDKRTVAGHQPPVSVYPGQPPADSAICRGRPPA
FT                   YVSMIVIDTIERTLADQGVTLFAMVDALINGRSVCCSMFAGDFQSTDPSYLINSSEAVG
FT                   LSVVLIVKLTLRSSRIDQGSSTKFRSINPPRNRSTRLARNPTPAISQQSWESGQAR"
     atggagggtg ggggagggct aggtagtatg ggtaacaggg ataagagaac cgtggcaggt        60
     caccaacctc ccgtcagcgt atatcccgga caaccaccag ctgactcagc catctgccgc       120
     gggcgaccgc ctgcgtatgt gagtatgatt gtcatcgaca cgattgaacg gaccctcgca       180
     gatcaaggag ttactttatt cgcgatggtc gatgctttaa ttaatggacg gtcagtgtgt       240
     tgctccatgt ttgctggaga tttccagagc accgatccca gttatttgat caatagtagt       300
     gaggccgttg gtctttctgt agtattgatt gttaagttaa ccctgcggtc ctcgcgcatc       360
     gaccaaggca gcagtactaa gtttaggtca attaatccac ccaggaaccg atccaccaga       420
     cttgcaagga acccaactcc agcaattagc cagcagagtt gggaaagcgg tcaggccagg       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page