(data stored in ACNUC7421 zone)

EMBL: AM269964.PE14

AM269964.PE14        Location/Qualifiers
FT   CDS_pept        join(26756..26796,26871..26888,26981..27419,27491..27859)
FT                   /locus_tag="An01g04970"
FT                   /note="Function: human CTNS is a lysosomal cystine
FT                   transporter."
FT                   /note="Function: mutations in human CTNS cause nephropathic
FT                   cystinosis, an autosomal recessive disorder resulting from
FT                   defective lysosomal transport of cystine."
FT                   /note="Localization: human cystinosin-green fluorescent
FT                   protein colocalizes with lysosomal-associated membrane
FT                   protein 2 (LAMP-2) to lysosomes."
FT                   /note="Title: strong similarity to lysosomal cystine
FT                   transporter cystinosin CTNS - Homo sapiens"
FT                   /note="lysosome"
FT                   /note="See PMID 9537412"
FT                   /note="See PMID 10673275"
FT                   /note="See PMID 11150305"
FT                   /db_xref="GOA:A2Q8N4"
FT                   /db_xref="InterPro:IPR005282"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N4"
FT                   /inference="profile:PFAM:PF04193"
FT                   /inference="similar to AA sequence:UniProtKB:AF168787.2"
FT                   /protein_id="CAK37031.1"
FT                   /translation="MATQLEIFVRALSRLLGWIYTFCWSASFYPQPINNFRRRSTTGLA
FT                   IDFPTINVLGFVCYTIYTSAFLYSPVIRHQYAARHPLAEDPTVRFNDFAFALHAVVLSF
FT                   ITYTQFWPFIWGFKVSRHQKVSKPVAGLFWGSIVGVTIVIFIVLGQSPNNGYDPYSWAW
FT                   IDVIYALSYVKLVITIVKYVPQAWVNYKRKSTYGWSIGQILFDLSGGVLSLAQLLLDSS
FT                   FQDDWSGVTGNPIKFLLSNVTIFFDLIFVVQHYILYRDAVDDSGKDRNPSDRTPLLSVS
FT                   DGQPGRS"
     atggcaactc agctagagat tttcgtgagg gcgctttctc gcctactcgg ctggatatac        60
     acgttctgtt ggtctgcgtc cttctatccc cagccgatca acaacttccg gcgacggtcg       120
     acaacggggc tggcaatcga ctttcctacc atcaacgtgc tgggcttcgt gtgctatacc       180
     atatatactt ccgctttcct ttactctccc gtgatccgtc atcaatatgc tgctcgtcac       240
     ccacttgctg aggacccgac cgtgcgcttc aacgactttg ccttcgccct acatgctgtc       300
     gtccttagct tcatcacgta tacacagttc tggccattca tctgggggtt caaggtctct       360
     cgccatcaga aagttagcaa gccggtagca ggccttttct ggggctctat agtcggcgtc       420
     acgatcgtga tcttcatcgt tctcggtcag agcccaaata acggctatga cccatactcc       480
     tgggcgtgga tcgatgttat atatgccctt tcttacgtga aactggtcat caccatcgtg       540
     aagtacgtac ctcaagcgtg ggttaactat aagcgtaaat ccacatacgg ctggagtatc       600
     ggacagatct tatttgattt gtctgggggt gtcttatccc ttgcccagtt gctgctggat       660
     tctagcttcc aagatgactg gagtggagtc acaggaaatc ccatcaagtt ccttttgtcg       720
     aacgttacca tctttttcga tctgatcttt gtggtacagc actatatcct ctacagagat       780
     gcagtggacg atagcggtaa ggaccggaac ccgagtgatc ggactccttt gttgtccgtg       840
     tccgacggac agcccgggcg cagttag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page