(data stored in ACNUC7421 zone)

EMBL: AM269964.PE15

AM269964.PE15        Location/Qualifiers
FT   CDS_pept        join(29734..29840,29928..30885)
FT                   /locus_tag="An01g04980"
FT                   /note="Function: Fusarium sp. Tri6 is involved in the
FT                   regulation of enzymes, of the trichothecene toxin
FT                   biosynthesis pathway."
FT                   /note="Remark: the predicted A. niger protein contains a
FT                   zinc-finger-domain in the C-terminus."
FT                   /note="Remark: trichothecenes are sesquiterpenoid
FT                   mycotoxins and act as protein synthesis inhibitors for
FT                   eukaryotic organisms."
FT                   /note="Similarity: the predicted A. niger protein shows
FT                   strong similarity to Tri6 transcription activators of
FT                   several Fusarium species (F. graminearum, F. cerealis, F.
FT                   sporotrichioides)."
FT                   /note="Title: similarity to transcription activator Tri6
FT                   -Fusarium cerealis"
FT                   /note="nucleus"
FT                   /note="See PMID 10635566"
FT                   /db_xref="GOA:A2Q8N5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N5"
FT                   /inference="profile:COGS:COG5048"
FT                   /inference="similar to AA sequence:UniProtKB:AB017496.1"
FT                   /protein_id="CAK37032.1"
FT                   /translation="MHPSPPTCDKPFKEIGFIPLRHPESPRYMNYKYRRSRVSRALLSS
FT                   SEPSAMTSRTTINRAMLMVPGGSSTHSTMSSEVQPYLFPAIAFQQAPLSDARSMSGSVP
FT                   YAFDQAQPLHQRKPDVGTHYFQDQESYTPLFSNQTIPPQSFRPDIESFPPAIPTTDGAY
FT                   FPIDQEEWLAIAVSQSPLNPTNTDYYLPESAPSSFSQSRLTPVTTASLSSATTADLDFE
FT                   LDLDLDLDDLQLQSLSDTSSARSQTRDLTNYGIKNPDGTWRCAYPGCSSHAVFRRGCDL
FT                   RKHYNRHRKHLFCRYEGCPQAVRGGFSSKKDRDRHEAKHNPEIPCEWDGCQRVFSRVDN
FT                   MKDHVRRIHKRRET"
     atgcatccaa gcccaccaac ttgtgacaaa ccattcaaag aaataggctt catcccactg        60
     agacatcccg agtcccctcg atacatgaac tacaagtacc gccgaagccg cgtgtccagg       120
     gcacttttat ccagttccga accatccgca atgacctcta ggactacaat caacagagcc       180
     atgctgatgg tgcccggcgg ctcctcaacc cacagtacga tgtcgtcaga ggtgcagcca       240
     tatctttttc ccgctatagc ctttcaacag gcccccctgt cagatgcccg cagcatgtct       300
     gggtcagttc cctacgcctt cgaccaagca cagcccctcc atcaaaggaa accagacgtt       360
     ggaacccact actttcagga ccaagagtcc tatacaccct tattctcaaa tcagaccata       420
     ccaccacagt cattcagacc cgatattgaa tcctttcccc cagccatacc aaccacagac       480
     ggtgcatact tccctatcga tcaagaagaa tggctcgcga tagcagtatc acagtcacct       540
     ctcaacccta caaatacaga ctattacctc ccagagtcag ctccatcctc cttctctcag       600
     tcacggctaa cccccgtaac caccgcatct ttatcttccg ccaccaccgc agaccttgac       660
     ttcgagcttg atctcgacct cgatctagac gatctccaac tccaatccct atccgacacc       720
     tcctccgccc gcagccagac gcgagatcta accaactacg gcattaaaaa tcccgacgga       780
     acctggcgct gcgcatatcc cggctgctca tcacacgccg tcttccgtcg gggctgtgat       840
     ctccggaaac actataatcg tcaccgcaaa catctctttt gccggtacga agggtgtccg       900
     caggctgtgc ggggcgggtt ctccagcaag aaagacagag atcgacatga ggcaaaacac       960
     aacccagaaa taccttgtga gtgggacggg tgtcagcggg tatttagtag ggtagacaac      1020
     atgaaggatc atgtgaggag gattcataag aggagggaga cttga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page