(data stored in ACNUC7421 zone)

EMBL: AM269964.PE16

AM269964.PE16        Location/Qualifiers
FT   CDS_pept        complement(32720..33931)
FT                   /locus_tag="An01g04990"
FT                   /product="hypothetical protein"
FT                   /note="Similarity: the predicted A. niger protein shows
FT                   local similarity to the integrase gene in Pseudomonas
FT                   putida (aa 169-317)"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N6"
FT                   /protein_id="CAK37033.1"
FT                   /translation="MTESYGLDEPRTPGLRPTEIDYLPKVSPPPFDTGDQSPKGGLPKH
FT                   DAEAQFPSSSRKLPEFQKPDSTEGNSVLIRHLEPNRPDIAWFETEHPLQRSTIADDFPV
FT                   LPKIIFGPEKSSVETKEPVDVVARKALNLISPSEPKEGGPSVAPKDLPVAYKEPPRRPS
FT                   IPVEEPALKEEQQQQHTPPNIPHFSHLFQDGKLPDPETRLGKLLIAPSEPAAQLPALHP
FT                   STTASAVNHNLPSLSTALAGVTDVPPPASAGRLNGSSFGPLPPVSASSPPVSRTDPVWE
FT                   HQRLGQIPPPPPQVPPSPYSHLSPASSKDMSAMSSPASQQAYWRPPIKADITYLTSTYE
FT                   TAPQTAKSPATSYPTPTDQTPASTCDRSYNPPTHPNGAVSTGTYKCRHPGCTAAPFQTQ
FT                   YLLK"
     atgacagaat catacggtct cgatgaacct cgcacccctg ggttgcggcc cacagagatt        60
     gattacttac caaaggtgtc accgcctcca ttcgataccg gggatcaatc acccaagggc       120
     ggtctaccca agcacgatgc agaggcacag tttccgagca gttcgcgtaa gctgccggaa       180
     ttccaaaagc ccgattcaac tgagggcaac tcggtgctga tcagacatct agagcctaac       240
     cgacctgaca tagcctggtt cgaaactgaa catccgcttc aacgcagcac tatagcggac       300
     gactttccgg ttcttcctaa gatcatattc ggcccagaga aatcctccgt ggagaccaag       360
     gagcctgtag acgtggtcgc gagaaaagct ctcaatttga tcagtccgag cgagcccaag       420
     gaaggaggcc catccgtagc cccgaaggat cttccagtcg cttacaagga accaccacgc       480
     cgaccgtcta tcccagtgga agaacctgcg ctcaaagaag aacagcagca gcagcacacg       540
     ccgcctaaca tcccccattt ctctcatctg tttcaagatg ggaaattacc tgatcctgaa       600
     acacgcctgg gcaagttgct gatagcacca tcggagccag cagctcagct ccccgccctc       660
     cacccatcaa caacggcgag cgccgtgaac cataatctgc cctctctttc aacggcattg       720
     gctggtgtta ccgatgtacc accacctgct agtgccggac gcttgaatgg ctcgtctttc       780
     ggccctttgc ctccagtctc agcttcttcc cccccggtgt caaggacaga tcctgtctgg       840
     gagcaccaac gcttaggcca aattccgcct cctccgccac aagtcccgcc cagcccctac       900
     tcgcacttgt caccggcaag ctcgaaggat atgtcggcta tgtcgtcgcc cgcatcccag       960
     caggcttact ggcggccgcc tatcaaggcg gacataacgt atctcacttc aacgtatgag      1020
     actgcaccgc agacagccaa gagccccgca acaagctatc ccaccccgac agatcagact      1080
     ccagcatcca cctgtgatcg gtcatacaat ccccccacgc atccgaacgg agcggtctcc      1140
     acaggcacgt acaaatgccg tcacccgggc tgcactgcag ccccgttcca aacacaatac      1200
     ctgttgaagt aa                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page