(data stored in ACNUC7421 zone)

EMBL: AM269964.PE17

AM269964.PE17        Location/Qualifiers
FT   CDS_pept        join(37614..37630,37671..37689,37749..37835,37908..38168)
FT                   /locus_tag="An01g05000"
FT                   /note="Similarity: similarity is between the N-terminal
FT                   regions of the predicted A. niger protein and the
FT                   polyguluronate lyase gene of Corynebacterium sp. (aa
FT                   7-67)."
FT                   /note="Title: weak similarity to polyguluronate lyase alyPG
FT                   - Corynebacterium sp."
FT                   /note="See PMID 9491925"
FT                   /db_xref="GOA:A2Q8N7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N7"
FT                   /inference="similar to AA sequence:UniProtKB:AB030481.1"
FT                   /protein_id="CAK37034.1"
FT                   /translation="MGLRAKPGNLLKLSDRSSLLLIGQSVKPSNHPILDSFRLRPWFGL
FT                   VCVGTLVSIRALPSTVNPNGSGARLKEGPLPFPYQSGKGVSSWFEPDVVEITSRTGSKA
FT                   PSCLLLFVRLPRWNDILIHLKFG"
     atggggctca gagccaagcc agggaatcta cttaagctct ccgaccgatc ttcattatta        60
     ttaatcggtc aatcagtcaa accatcaaac catccaattc ttgattcctt cagacttcgg       120
     ccgtggtttg gtttggtttg cgtcggaact ttggtttcga tccgtgcatt acccagtacc       180
     gtgaatccga acgggtctgg ggcacggtta aaggagggtc ccctcccctt tccctaccag       240
     agcgggaaag gtgtgagtag ttggtttgag ccggacgttg tggaaattac cagtaggacg       300
     ggatcaaagg ctccatcatg tctattgcta tttgtgcgcc taccgagatg gaatgacatt       360
     cttatccact tgaaatttgg ttga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page