(data stored in ACNUC7421 zone)

EMBL: AM269964.PE21

AM269964.PE21        Location/Qualifiers
FT   CDS_pept        join(43139..43478,43560..43732,43816..43899)
FT                   /locus_tag="An01g05040"
FT                   /EC_number="3.6.1.23"
FT                   /note="Complex: dUTP pyrophosphatases are homotrimeric
FT                   enzymes."
FT                   /note="Function: dUTP pyrophosphatases hydrolyze dUTP to
FT                   dUMP and pyrophosphate, preventing the incorporation of
FT                   uracil into DNA during replication, and are involved in DNA
FT                   replication and DNA repair."
FT                   /note="Title: strong similarity to dUTP pyrophosphatase
FT                   DUT1 - Candida albicans"
FT                   /note="See PMID 7874734"
FT                   /note="See PMID 8223452"
FT                   /db_xref="GOA:A2Q8P1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P1"
FT                   /inference="profile:COGS:COG0717"
FT                   /inference="profile:COGS:COG0756"
FT                   /inference="profile:PFAM:PF00692"
FT                   /inference="similar to AA sequence:PIR:S51498"
FT                   /protein_id="CAK37038.1"
FT                   /translation="MTKETTPPPPTTTTTEPTTNTTHEPPSLPASPLAKRTKPNTTEQS
FT                   TEPSTMGSTSTPLPPLQVKKLTPTGRAPTRGSAFAAGYDMYSAKETVIPAKGKALVDTG
FT                   IAIAVPEGTYGRIAPRSGLASKHFIDTGAGVIDADYRGEVKVLLFNHSDVDFEVKEGDR
FT                   VAQLVLERIYTPEVVVVEELAESVRGAGGFGSTGV"
     atgaccaagg agaccacccc tcctcctccc accaccacca ccaccgaacc tactacaaac        60
     acaactcacg agcccccctc cctccccgcc tctcccctcg ccaagcgcac caaacccaac       120
     accaccgagc aatcaacaga accgtccaca atgggttcaa ccagcacccc tctccccccc       180
     ctccaagtga agaagctcac tcctaccggc cgcgccccga cccgcggctc tgccttcgcg       240
     gccggatacg acatgtacag cgccaaggag accgttattc ctgctaaggg gaaggcgttg       300
     gttgatacgg gaattgcgat tgctgtgccg gaggggacgt acggcagaat cgcccctcgc       360
     tccggcctcg cctcgaagca cttcattgat actggcgcgg gcgtcatcga tgcagactac       420
     cggggagagg tcaaggttct tttgtttaat cattcggatg tggatttcga ggtgaaggag       480
     ggagatcgcg ttgcgcagtt ggttttggag aggatctata cccctgaagt tgtggttgtg       540
     gaggaattgg cggagagtgt tcgtggcgct ggtgggtttg gaagtactgg tgtttaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page