(data stored in ACNUC7421 zone)

EMBL: AM269964.PE22

AM269964.PE22        Location/Qualifiers
FT   CDS_pept        complement(join(44146..44773,44824..44941,45001..45213,
FT                   45264..45343,45423..45433,45491..45544))
FT                   /locus_tag="An01g05050"
FT                   /EC_number="2.7.1.35"
FT                   /note="Catalytic activity: pyridoxal kinases convert ATP +
FT                   pyridoxal to ADP + pyridoxal-5-phosphat."
FT                   /note="Function: human PKH is required for the synthesis of
FT                   pyridoxal-5-phosphate (PLP)1, an essential cofactor for
FT                   numerous enzymic reactions of intermediary metabolism, from
FT                   vitaminB6."
FT                   /note="Remark: an alternative name for human PKH is PNK."
FT                   /note="Title: strong similarity to pyridoxal kinase PKH
FT                   -Homo sapiens"
FT                   /note="See PMID 9099727"
FT                   /db_xref="GOA:A2Q8P2"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P2"
FT                   /inference="profile:COGS:COG0351"
FT                   /inference="similar to AA sequence:SWISSPROT:PDXK.HUMAN"
FT                   /protein_id="CAK37039.1"
FT                   /translation="MSADLLVPETRVLAVASHVVYGYVGNKMASAVMQLMGCDVAALNT
FT                   VHFSNHTGYRQFKGTRATAEEITALYEGLTQSNLLDFDVMLSGYAPSAAAVEAVGAIGM
FT                   DLQRKAEKNPGSFFWVLDPVMGDQGRLYVNDDVVPAYKKVIRHADLILPNQFEAEVLSG
FT                   IKITSLATLAEAITALHAIYNIPHVIITSVQIASLSDSPLPNTLTVIGSTTRSDGAPRL
FT                   FRIDVPALDCYFSGTGDMFAALTVARFREAVFNADPTLRNTKSWVSPDNVPATELPLAQ
FT                   STRKVLASMHCVLEKTLEARDAELRAIVPDESEKLLSQEDQQKRAHLRESKAAEVRVVR
FT                   HAQYLREPEVEFQASEWRREDLPAQFR"
     atgtccgccg atcttctcgt ccctgagacc agggtcttgg ctgtcgccag ccatgttgtc        60
     tacggatatg tgggcaataa gatggccagt gcggtcatgc agctcatggg ctgtgatgtc       120
     gccgccctga acaccgttca cttcagtaac cacactggtt atagacaatt caagggcact       180
     agggccacag cagaggagat caccgcgctc tatgagggtc tcacgcagag caatttactt       240
     gactttgatg tcatgctctc tggctatgcg cccagtgcag ctgccgtcga ggccgtcggg       300
     gccattggca tggacctcca gcgcaaagcg gaaaagaatc ccggttcctt cttttgggtt       360
     ctggaccccg taatgggcga ccaaggccgt ctctacgtca acgacgacgt cgtccccgca       420
     tacaagaagg tcatccgcca cgcagacctc atcctcccca accaattcga agccgaagtc       480
     ctctccggca tcaaaattac ctccctcgcc accctcgctg aagccattac cgctcttcac       540
     gccatataca acatccccca cgtgatcatc acctccgtgc aaatcgccag cctctccgac       600
     tctccgctcc ccaacaccct caccgtcatc ggctcgacca cccgctccga cggtgccccg       660
     cgtctctttc gcatcgacgt ccccgccctg gactgctact tcagcggcac cggcgacatg       720
     ttcgccgcac tcacggtagc ccggttccgc gaggccgtgt tcaacgccga tcccaccctc       780
     cgcaacacca aatcatgggt ttcgcccgac aatgtccctg caacggagtt gccccttgct       840
     cagtctaccc ggaaggtgct ggcgagtatg cactgcgtgc tggagaagac gctagaggcg       900
     agagatgccg agttgcgcgc cattgttccg gatgagagcg agaagctgct cagccaggag       960
     gaccagcaga agagggcgca tctgcgggag agcaaggcgg cagaggtacg ggtggtacgg      1020
     catgcgcagt atctgcggga accggaggtg gagtttcagg cgagcgagtg gcgacgggag      1080
     gatctgccgg cgcagtttcg ttga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page