(data stored in ACNUC7421 zone)

EMBL: AM269964.PE23

AM269964.PE23        Location/Qualifiers
FT   CDS_pept        46392..47492
FT                   /locus_tag="An01g05060"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   EAA66142.1 - Aspergillus nidulans"
FT                   /db_xref="GOA:A2Q8P3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P3"
FT                   /protein_id="CAK37040.1"
FT                   /translation="MVSIYTPRARSARQHSQQQQLSILLCTLLALPSVLGSVLPSTAEI
FT                   SSGEIVNADLSAAHTTTTNTDQPLSLSLSPDIFTTTTTNANDDTSNLTLHPRSTTTNTT
FT                   SISTDTTDTSSSTFPTAFDTSLTNNFTTTTCATFFHNLLSNTTLTSCHAISLLLRDSTS
FT                   FFHALTSAPTTSSILDTACASNLTTCSTALTSLASQLLQSSTCLHDYNAGNQAVVSAYT
FT                   DLITYAPIYRATCLQSPETNNYCFVDAVTNTSNSVDYDVYFVPYGSAIDAAPWPTCNEC
FT                   LQATLNVYKEYASVDGQPLAESYLPTARGVNGVCGSGFADVNVTVGVVKDGVSSGGAGG
FT                   RFGGGSWGVMVVVVVGWSVGWVIGVV"
     atggtgtcca tctacacgcc ccgtgctcgc tcagcacgac aacattcaca acaacaacaa        60
     ctatccatcc ttctctgcac cctacttgcc ctcccatccg tgctaggatc cgtgctgcca       120
     tccaccgcag aaataagcag tggggagatc gtcaatgcgg atctctccgc agcacatacc       180
     accaccacca acacagatca accactatca ctatcactat caccagatat cttcaccacc       240
     acaaccacca acgccaacga cgacaccagc aacctcaccc tgcacccccg cagcaccacc       300
     accaacacca catccatatc caccgacacg accgacacat catcatccac attccccacc       360
     gccttcgaca cctccctaac caacaacttc accaccacca cctgcgccac cttcttccac       420
     aacctcctat ccaacaccac cctgacctcc tgccacgcca tctcgctcct cctccgcgac       480
     tcgacctcct tcttccacgc cctcacctcc gcccccacca cctcctccat cctcgacacc       540
     gcctgcgcct cgaacctcac cacctgcagc accgctctca cctccctcgc ctcgcaactt       600
     ctccaatcat ccacctgcct gcacgactac aacgccggaa accaagccgt cgtatccgcc       660
     tacactgatc tcattaccta cgcgcccatc taccgcgcca cgtgcctgca gtctccagag       720
     acgaacaact attgctttgt ggatgcggta acgaatacca gtaattctgt ggactatgat       780
     gtgtatttcg tgccgtatgg gagtgccatt gatgcggcgc cgtggcccac gtgtaatgag       840
     tgtttgcagg cgacgttgaa tgtgtataag gagtatgcga gtgtggatgg gcagccgttg       900
     gcggagagtt atttgccgac ggcgaggggg gtgaatgggg tgtgtgggag tgggtttgcg       960
     gatgttaatg ttacggtggg ggtggtgaag gatggggtta gtagtggtgg tgctgggggg      1020
     aggtttgggg gaggcagttg gggggtgatg gtggtggtgg ttgtggggtg gagtgttggc      1080
     tgggtgattg gggtggttta g                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page