(data stored in ACNUC7421 zone)

EMBL: AM269964.PE24

AM269964.PE24        Location/Qualifiers
FT   CDS_pept        complement(join(47784..49454,49508..49568,49621..50252))
FT                   /locus_tag="An01g05070"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SPBC776.06c - Schizosaccharomyces pombe"
FT                   /db_xref="GOA:A2Q8P4"
FT                   /db_xref="InterPro:IPR012860"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P4"
FT                   /inference="similar to AA sequence:PIR:T40676"
FT                   /protein_id="CAK37041.1"
FT                   /translation="MSISLPYRPADDSTLSLAATTNPSKANGHPRLSPSPSIIHRRTPS
FT                   SSGNSARRRSLGQGPSTLYPRPRRCKSQYPRDSPERHVEYILVASFHIDRGPIMEHQYP
FT                   AAISGDESMLAELMLPDQTHVRSQDWTIFFLHKDTSADADEDDASTGKKKKKKKSRIGD
FT                   AESGDGDSEDVGGSTEEESSDEEEGGEGPPLMYVLNLVNTKQDTSVKRGAVVKAMAICT
FT                   RHSFLHIYKPLLLLALEDYFKNPYPETLASLYDAVNAMDLSLMPRLSLLERLILQASNC
FT                   KDMFIEKFEQMIHQRQVEDGGPFDEEPPSPKRPAAPRYTLPRDTHEFESKIVYNDIPIP
FT                   VKVPTVIWPEVVGDFSLIKLIQIFSTPHAASPQPFPIHPHLTTSGPFTHPIIVLVNAML
FT                   TQKRVIFLGHNRPSGEVAEAVLAACALASGGILRGFTRHAFPYTDLTKIDDLLRVPGFI
FT                   AGVTNPTFANHPEWWDVLCDLPTGRMKISSHIEPAPVTEGLLYFQQQAAMHHHPPPSNN
FT                   ADPSGDNVFMEEVQRSITNRYGENAIRAKWRAYIAKFTRVAAAFEETVYGASNLYVIGP
FT                   NEELSPESPSGLQADPLDPTTLRGHGYVWPDEGSKQRELMASVARIEGWRTTRSYYSFI
FT                   QDIAAMYYPSRPIQKPDLHHHHDRLRALRLPPADAGAIYISFAHAVKDYAGICQLLTVT
FT                   PENQAGLFYLGMGLFHPHQPVREAAVDLLERIAAHPAGRHFWAQLNRFTKLAFFRIKRE
FT                   RDASTQSPASGLGNESFGPQSLVGVALGDSFRRS"
     atgagcatct cactacccta ccgacctgct gatgattcca ccctctcgct tgcggccacg        60
     accaatcctt ccaaggccaa tggccatccc cgcctatccc cttccccttc catcatccac       120
     cggcgcaccc ccagtagttc ggggaactcg gcgcgccgtc gctcgctggg ccaaggtccc       180
     tctactcttt accccagacc gcgacgatgc aaatcgcaat acccccgaga ttcgcccgag       240
     cgacatgtcg agtacatcct tgtggcctcg ttccacatcg accgcggccc gatcatggag       300
     catcagtatc ccgccgcaat cagtggcgac gagagtatgc tagcggaact gatgcttccc       360
     gatcagacgc acgttcggag tcaggactgg acgatcttct tcttgcacaa ggacacaagc       420
     gcggatgccg acgaggacga cgctagtact ggcaagaaaa agaagaaaaa gaagtcccgg       480
     ataggggacg cggagagcgg cgacggggac agcgaagatg taggcgggtc aaccgaagag       540
     gagagcagcg acgaagaaga gggtggcgag gggccaccct tgatgtatgt gctcaacctt       600
     gtaaatacga agcaagatac ttccgtcaaa cgtggtgcag tcgtcaaagc catggcgatt       660
     tgtacgcgac attctttcct acatatatat aaacctttac ttctcttggc cctggaggat       720
     tacttcaaga acccctaccc ggagacgctc gcatcgttat acgatgccgt gaacgccatg       780
     gacctgtcgt taatgccgag gctatcgctt ttagaacgac tgatcttgca ggcaagcaac       840
     tgtaaggata tgttcattga gaaattcgag cagatgatcc accagcgaca agttgaagat       900
     ggcgggcctt ttgacgaaga gcccccgtcc ccgaaaaggc cagccgcccc tcgatacacg       960
     ctaccccgag atacccacga gtttgagtct aagatcgtct acaacgacat tcctattcct      1020
     gtcaaggtgc cgacggtcat ttggccggag gttgtgggcg acttttccct catcaagctc      1080
     atccagatct tttctactcc gcatgcggcc tcgccacagc cgtttcccat ccatccccac      1140
     ctcactacga gcgggccctt tacccatccg atcattgtcc tcgtcaacgc catgttgact      1200
     cagaagcgag tgatattcct ggggcataat cgcccttcag gcgaagtggc agaggcagtg      1260
     ttggcggcgt gcgcccttgc gtcgggcggc atattgcgcg ggttcaccag acacgcattc      1320
     ccgtacaccg atttgacgaa gatcgatgac ctgctgaggg tccctggttt cattgctggc      1380
     gtcacaaatc ctacctttgc caaccatccc gaatggtggg atgtgctctg cgatttgccc      1440
     acgggccgaa tgaagatcag cagccacatt gagccggccc cagtcaccga aggactcttg      1500
     tatttccagc aacaagccgc catgcaccac cacccaccgc cgagtaacaa tgcagatccc      1560
     agtggggaca atgtctttat ggaggaggtt cagcgcagca tcaccaaccg atacggcgag      1620
     aatgccatcc gggcgaagtg gcgcgcctat attgccaagt tcacccgggt tgctgcagcc      1680
     ttcgaggaga cagtctatgg ggcatccaat ctttacgtta tcggacccaa cgaagagctt      1740
     tcgcccgaaa gtccaagcgg ccttcaggcg gatccactcg atccgacaac actccgtgga      1800
     cacggttatg tgtggccgga cgaggggtcc aagcaacgcg agctgatggc gtcggtggcg      1860
     cggattgaag gctggcggac gacgcgatcg tattattcct ttattcaaga tattgcagcc      1920
     atgtattatc cctcacggcc gattcagaag ccggacctac atcatcacca tgaccggctg      1980
     cgggcgctga ggctcccgcc ggccgatgcg ggggcgatct acatttcgtt tgcacacgcg      2040
     gtcaaagact acgcaggcat ctgccaactc ttgaccgtga ctccggagaa ccaggcggga      2100
     ctcttctacc tcggcatggg attgttccat ccgcaccagc cagtgcgcga ggcggcggtc      2160
     gatctcctag agcgcattgc ggcgcatccg gcgggacgac acttttgggc gcagctcaac      2220
     cggttcacca agctggcctt cttccggatt aagcgggaga gagacgcatc gacacagagc      2280
     ccagcgtcag gcttggggaa tgagagcttc gggccccaaa gcctggtagg ggtagcgctg      2340
     ggcgacagtt tccgacggag ttag                                             2364
//

If you have problems or comments...

PBIL Back to PBIL home page