(data stored in ACNUC7421 zone)

EMBL: AM269964.PE25

AM269964.PE25        Location/Qualifiers
FT   CDS_pept        join(51118..51120,51179..51653,51735..52135)
FT                   /locus_tag="An01g05080"
FT                   /note="Similarity: similarity is from the C-terminal half
FT                   of the predicted A. niger protein to myosin regulator light
FT                   chain from P. yessoensis, which is 100 aa shorter."
FT                   /note="Title: similarity to myosin regulatory light chain
FT                   -Patinopecten yessoensis"
FT                   /note="cytoskeleton"
FT                   /note="See PMID 6706905"
FT                   /db_xref="GOA:A2Q8P5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P5"
FT                   /inference="profile:COGS:COG5126"
FT                   /inference="profile:PFAM:PF00036"
FT                   /inference="similar to AA sequence:PIR:A28863"
FT                   /protein_id="CAK37042.1"
FT                   /translation="MVTSNAPFRPSPLSFGSPRPSPFRRPSTPNSHPQGRSSTPGSSPG
FT                   RGYTPVQSPSKLKESYTVEEDDGSSPKSKPRSPIAQPRFTREAPPSPTRGANAPDSSPS
FT                   LMEAKATNMMAASSDAAAKLPPAQLREIREAFQVLDRDNDGLVDKDDVADVLTNVDPTA
FT                   LSKFFPLGGPQTMNFPTFLNTLSQLLAPLSSRQELMNALAAFDEDDSGQIDVDELRDAL
FT                   LHTASEDGDHPLSDREINEVLSGFTGRRAFGGKGARAAGGGKRGEVFRYQDFVSGIMGG
FT                   TENGSTNRRDA"
     atggtcacct ccaacgcccc cttcaggcca tcgccattat catttggctc ccctcgaccc        60
     tccccttttc gccgtccttc tacacccaac tcccatccac aaggccgctc aagcacccct       120
     ggcagttccc ccggccgcgg ttacactccg gttcagtcac cgagcaaact caaggaatca       180
     tacaccgtcg aggaagatga cggttcatca cccaagagca agcccagaag tcccattgca       240
     cagcctcggt tcacacgaga ggcgccccct tcgccaacga ggggcgccaa tgcgccggat       300
     tcgtcgccgt cgttgatgga agccaaagct acgaacatga tggcggcgtc atctgacgca       360
     gcagctaaac taccccccgc acaactgcgg gaaatccgag aggccttcca agtcctggac       420
     cgagataacg atggcttagt agataaggac gacgtggcgg atgtgcttac gaacgtggac       480
     ccgactgccc tttccaagtt cttccctcta ggaggtcctc aaaccatgaa tttccccacc       540
     ttcctcaata ccctctcaca gctgctcgct cctctttctt cccgccaaga gctcatgaat       600
     gccttggcgg ccttcgacga agacgatagc ggtcagatcg acgtcgacga gctgcgcgat       660
     gccctcttac acacagcatc cgaggatgga gaccaccctc taagcgaccg ggagatcaat       720
     gaagtgctca gtggatttac ggggcgccga gcatttggcg ggaaaggtgc tcgggcggcg       780
     ggcggaggga agagggggga ggtattccga taccaggact ttgtcagtgg gatcatggga       840
     gggacggaga atggatcgac gaatcgccgc gacgcctag                              879
//

If you have problems or comments...

PBIL Back to PBIL home page