(data stored in ACNUC7421 zone)

EMBL: AM269964.PE26

AM269964.PE26        Location/Qualifiers
FT   CDS_pept        join(53038..53409,53500..53735,53865..54278,54612..54735)
FT                   /locus_tag="An01g05090"
FT                   /note="Complex: S. pombe cdc16 forms a heterodimer with
FT                   byr4, which then binds spglp."
FT                   /note="Function: S. pombe cdc16 is required for p34cdc2
FT                   kinase activity and septum formation."
FT                   /note="Function: S. pombe cdc16 negatively regulates
FT                   septation via Spglp GTPase and its effector cdc7 kinase."
FT                   /note="Function: S. pombe cdc16 together with byr4 forms a
FT                   two-component GTPase-activating protein (GAP) regulating
FT                   Spglp GTPase."
FT                   /note="Localization: using indirect immunofluorescence byr4
FT                   localises to the spindle pole bodies except during
FT                   mitosis."
FT                   /note="Similarity: S. pombe cdc16 belongs to the
FT                   superfamily of cell cycle arrest proteins BUB2."
FT                   /note="Title: strong similarity to cell division control
FT                   protein cdc16p - Schizosaccharomyces pombe"
FT                   /note="centrosome"
FT                   /note="See PMID 9742395"
FT                   /note="See PMID 11271422"
FT                   /note="See PMID 8334988"
FT                   /db_xref="GOA:A2Q8P6"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P6"
FT                   /inference="profile:COGS:COG5210"
FT                   /inference="profile:PFAM:PF00566"
FT                   /inference="similar to AA sequence:PIR:S35315"
FT                   /protein_id="CAK37043.1"
FT                   /translation="MRGLRKIQSHQILSSHPPSSAHPPSGRLSAGAGELAQPPQLDSPV
FT                   RLRSQRRARSNSDASSREAPAIGTQKRSARKTGSGFGVKRSVLETLLRDGPHQGNLQEG
FT                   LQELRYLVLSTRVEADADGMSTYRIYLWLVLLDVSPVPTDEYLSLIHRGRSPAYTKIRN
FT                   DTFRTMATDPLFKRRVTEASLIRLLNAVAWKLHDAKNKYRGITNESAIYVQGMNVLCAP
FT                   FLYAARSEVEAFALFHSFITRECPGYIRGAMDGVHRGLRLVDQCLEIVEPKLAAYLFSK
FT                   GLQAKLYAFPSVLTLCACTPPLPEVLHLWDFLFAYGTHLNILCIVAQLIRMRDTILESP
FT                   NPNKILRSFPPLDAKEIIALTVLIVRKIPEPLYAELIDHAK"
     atgcgaggct tgcgcaagat ccagtctcac caaatcctct catctcaccc accttcctca        60
     gctcatccgc cgtcggggcg cttgtctgct ggcgccgggg agctcgccca acctcctcag       120
     ctggactcgc ccgtgcgact gcgctcgcaa cgccgggcgc gctccaacag cgatgcctcg       180
     tctcgggagg cccctgcgat aggaactcaa aagcgatcgg ccagaaagac aggttctggg       240
     tttggagtca agcgctcggt cttggagact ctcctccggg acggtccgca ccagggcaac       300
     cttcaggagg gtctccagga gctccggtac ctcgttctct cgacacgagt cgaagcagac       360
     gcggatggca tgtccaccta ccgaatctac ctttggctcg tccttctcga tgtttctcct       420
     gttccaaccg acgaatacct ctccctcatc caccgtggtc gctcgccagc ctacacgaaa       480
     atccgcaatg atacattccg caccatggcc acagaccccc tattcaaacg ccgcgtcaca       540
     gaagccagct tgatccggct tctcaacgct gtcgcatgga aacttcacga cgcgaagaac       600
     aaataccgcg ggattacaaa cgaatctgcg atctacgtcc aaggcatgaa cgtgctctgc       660
     gctccgttcc tctacgccgc ccgcagcgaa gtcgaggcct ttgctctgtt ccactcgttc       720
     attacacgcg aatgtcctgg ttacatccgc ggcgccatgg atggggtcca tcgaggtctg       780
     cgcttggtcg accaatgttt agagatcgtc gaacccaaat tagcggcgta cctcttctcc       840
     aagggcctac aggcgaaatt gtatgcattt ccgtcggtgt tgaccctctg tgcgtgcacg       900
     cctcctcttc cggaggtgct tcatctttgg gactttttgt tcgcatacgg aacgcaccta       960
     aatatcttgt gtattgtggc gcaattgatt cgaatgaggg acacgatcct ggaaagtccg      1020
     aatcccaaca aaatcctccg atccttccca ccactcgacg ccaaagagat catcgccctg      1080
     acggtcctga tcgtccgcaa gatccccgag ccgctgtacg ctgaattaat cgaccatgcc      1140
     aaatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page