(data stored in ACNUC7421 zone)

EMBL: AM269964.PE27

AM269964.PE27        Location/Qualifiers
FT   CDS_pept        complement(join(55953..56793,56849..57044,57096..57252,
FT                   57310..57390))
FT                   /locus_tag="An01g05100"
FT                   /note="Function: N. sylvestris cp29B exists as complex with
FT                   ribosome-free mRNAs and possibly acts as stabilizing
FT                   factor."
FT                   /note="Localization: N. sylvestris ribonucleoprotein B 29K
FT                   has been identified from a tobacco chloroplast lysate."
FT                   /note="Remark: N. sylvestris ribonucleoprotein B 29K is
FT                   nuclear encoded."
FT                   /note="Similarity: the predicted ORF contains the RNA
FT                   recognition motiv PF00076 (aa 273-314)."
FT                   /note="Title: weak similarity to ribonucleoprotein B cp29B
FT                   - Nicotiana sylvestris"
FT                   /note="See PMID 11038367"
FT                   /note="See PMID 1721701"
FT                   /db_xref="GOA:A2Q8P7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P7"
FT                   /inference="profile:COGS:COG0724"
FT                   /inference="profile:PFAM:PF00076"
FT                   /inference="similar to AA sequence:PIR:S20070"
FT                   /protein_id="CAK37044.1"
FT                   /translation="MPFPPREKGRMAKSGRSEEEFVLFLQGIPAHCRWQELKDLVRQTA
FT                   LHIRQAVVYDDQHGFPTGLGQIIVKNEDEAWRTYHRLSTNGWEGQSLVVTLARTSSPTR
FT                   PIAGPTKSPTCVIPPNYVPGYSTPPRSTQNMAVPPSPISPEPILSASPSCPTYPATDYG
FT                   PMVNPLAMPQQPFMPFPTDPVTQQPISGIPPSPAPLRHSFGDAFAIPVFPAYPFPTMPP
FT                   FPDAPAHGGFSLPGRRAHMSGKASYGYNPAFAPQIYHSGGPGPRSSPRRTIFVQNLSPT
FT                   TTDKLLRAFIEESGATVEQSEVSTDPDTGRCKGFARVTLRTADEAKRVVAQYNGINFMD
FT                   AKIRVKIDRSLHLAYSLTRERHAGSAPSANANSPVAKNQGPYGAGNSPRSSSLSSSTST
FT                   SSKSGDHCGPLVVNGSNTGTKAVAT"
     atgcctttcc ctccacgcga gaaggggcgg atggcaaaat ctggaaggtc agaagaggaa        60
     tttgttctat tcctccaggg gataccggcg cactgtcgtt ggcaagagct caaggaccta       120
     gtccgccaga cagccttaca tatccgtcaa gcagtggtct acgatgacca gcatggattc       180
     ccaaccggtc ttggacagat catcgtgaag aacgaagacg aagcatggag gacctaccat       240
     aggctttcta ccaacggctg ggaaggccag agccttgttg tcactttagc acgaaccagc       300
     tcacctacac gaccaattgc tgggcccacg aagagtccaa cctgcgtaat tccgcccaac       360
     tatgtaccag gctactcaac tccgccacga tcaacacaaa acatggcagt gcctccgtct       420
     cccatttccc ccgaacctat cttgtctgcc agtccaagct gcccgacata tccagccact       480
     gattacggcc ccatggtcaa tcccctagca atgcctcaac agcctttcat gcctttcccc       540
     acagacccag tcacacaaca gcccatatca ggcatcccgc cctcgcccgc tcctctccgc       600
     cactccttcg gcgacgcttt cgctattccc gtcttccccg catatccttt tccgaccatg       660
     ccgccgtttc ctgatgcccc agcacatggc ggttttagtc tacccggacg tcgggcccac       720
     atgtccggca aagcttccta cggctacaat ccggcgttcg cgccgcagat ctaccattcc       780
     gggggcccag gtccccgttc ttccccacga cgaactatat tcgtgcagaa tctcagtccc       840
     accacgaccg acaagctcct tcgcgccttc atagaagaaa gtggcgccac agtggagcaa       900
     tccgaggtgt ccacggatcc cgacaccggc cgctgtaaag gcttcgcacg ggtaacccta       960
     cgcacagcag atgaagccaa gcgtgttgta gcgcagtaca acggcatcaa ctttatggac      1020
     gcgaaaattc gcgtcaagat cgaccggagt ctccatctcg cttacagcct gacccgcgag      1080
     agacatgccg gttcggcacc atcagctaac gcgaacagtc cggtcgcaaa gaaccaagga      1140
     ccatatggtg ctggcaacag cccgaggtca tcatcgctgt cttcatcgac gtcaacgtcg      1200
     tcgaaatcgg gcgaccactg tggaccccta gtcgtcaatg ggtccaacac gggaaccaag      1260
     gcagtggcta cttag                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page