(data stored in ACNUC7421 zone)

EMBL: AM269964.PE28

AM269964.PE28        Location/Qualifiers
FT   CDS_pept        join(57831..57968,58054..58218)
FT                   /locus_tag="An01g05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8P8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P8"
FT                   /protein_id="CAK37045.1"
FT                   /translation="MAKSVEVGAEGAAAATAAGRVRRARIRIAKAVRMSEEMETERTVG
FT                   PGAQLVLESLRGKSGPDAWRRLGWVNLDELAKADGEEKVVVIAVEESRKDGVQAG"
     atggcgaaaa gtgttgaggt cggtgctgaa ggagcagcag cagcaaccgc ggcaggtaga        60
     gtaaggaggg ccagaataag aatagcaaag gcagtaagaa tgtccgagga aatggaaaca       120
     gagaggacag taggacccgg ggcgcagttg gtgctggaga gcttgcgagg gaaatccggg       180
     cctgatgcct ggagaagact gggatgggtc aacttggacg agctggcaaa ggcagatggg       240
     gaggagaagg tggtagtgat cgcagttgag gaatcgagga aggacggggt ccaagcaggc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page