(data stored in ACNUC7421 zone)

EMBL: AM269964.PE30

AM269964.PE30        Location/Qualifiers
FT   CDS_pept        complement(join(60389..60510,60751..60776,60856..60889,
FT                   61060..61156,61250..61471,61564..61699,61904..61944))
FT                   /locus_tag="An01g05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2Q8Q0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8Q0"
FT                   /protein_id="CAK37047.1"
FT                   /translation="MRRDAAIGSMAGVLLLDRPLLWCRQWWVSLISGPWLNSVVGLASF
FT                   HRLVYSLLGVHCAMDWLTVIRWLCAGDSDNNQLDGVTKCKSIMCAHMCVVPYKTSNIAE
FT                   RSARCHGRQTIYPMVTVSAEMSDNPRPSLLRSMVVVGSSELCPEESRAIDGSPNSACLS
FT                   QEVFNSPRTTVLLILVVHATATMGDPTRAAGPWAEGEGEGVPSNHPTKVYGVVWVDRPT
FT                   IEF"
     atgaggagag atgccgcgat cggatcgatg gcaggtgtct tattgcttga ccgacccctt        60
     ttgtggtgtc ggcaatggtg ggtgtcgctg atcagtgggc cgtggctcaa ttcagtcgtg       120
     ggtttggcct cgtttcatcg tctcgtctac tctctgctcg gggtccactg tgctatggat       180
     tggcttactg taattcggtg gctgtgcgct ggagactcag ataataatca acttgatggt       240
     gtcaccaagt gtaagagtat catgtgcgcg catatgtgcg tggtaccgta taaaacctca       300
     aatattgcag aacggtctgc ccggtgtcat ggtcggcaga cgatttatcc catggtcacc       360
     gtgtcagcgg aaatgtcaga taatccccga ccgagcctcc ttcgttccat ggtagttgtc       420
     gggtctagcg agttgtgtcc tgaggaatcg agggcgatcg acggatctcc caattcggcc       480
     tgtctcagtc aggaagtgtt caatagtccg cggactactg tgctgctcat cttagttgtc       540
     cacgcgaccg cgacaatggg agatcctacc agagccgcgg gcccgtgggc ggagggcgag       600
     ggcgagggcg tgcctagtaa tcacccaact aaagtctacg gtgttgtatg ggtcgatcgt       660
     ccgactatcg aattttag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page