(data stored in ACNUC7421 zone)

EMBL: AM269964.PE8

AM269964.PE8         Location/Qualifiers
FT   CDS_pept        join(16000..16261,16318..17468,17584..17622,17734..17880)
FT                   /locus_tag="An01g04910"
FT                   /note="Title: similarity to hypothetical protein EAK99938.1
FT                   - Candida albicans"
FT                   /db_xref="GOA:A2Q8M8"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M8"
FT                   /protein_id="CAK37025.1"
FT                   /translation="MPPPSQNIPLASTLVARFLRTNNYTQTLKAFLQEAGLPSDAGEQS
FT                   GKDDATNWTIENLIEEKKAYDQSKNFERYGDNDKDKDVWTVPAPTKPNIIQTPSSSNLL
FT                   ACSVGQWQRPDAQAEPYLIATGADKHLHLFQTSPGHDLVQSFTGTSEAPILSYIPVQDG
FT                   KYILMTNMSGQLLLQKGAEIIDRRKDHAKYAVKVIAYEQKNNNDTADTFSTTTTIWIAT
FT                   AGWDSKIFLYRMQINDEAPTQIGDPIASIPLLSNPESILFTTHIDNPQDLILLVSRRDS
FT                   SNLYYYHVKPSAVSTTGYECPLIGKQNLAPHSNAWVAFSPSCLALSPHDPGLIAIATST
FT                   LPHMKVMIVRLLFPSAESLESGSAEQEQEPATQAAQAFAALSLQNREDAAILIQANTFA
FT                   PQTAYSTPQVVWRPDGSGVWVNGDDGVVRGLEVKTGKVVTLLKDGHEVGCKIRTLWAGW
FT                   VDGENGGEREEWLFSSIHYQPTWATTQARMEKISTELYTHMPVSSPTSSSTSPPTTLRY
FT                   ENRTSEKQMNHQPRE"
     atgccacccc catcgcaaaa tatcccacta gccagcaccc tcgtggcccg ttttctacgg        60
     acaaacaatt acacgcaaac actcaaagct ttcctgcaag aagcggggct cccgtccgac       120
     gcgggagaac agagcggcaa agacgatgcc accaactgga ccatcgagaa tctgatcgag       180
     gagaagaaag cctatgacca aagtaagaac ttcgagagat atggtgacaa tgacaaggac       240
     aaagatgtct ggaccgttcc agcacccacc aagcccaaca tcatccaaac gccaagcagt       300
     tcaaacctac tggcatgctc cgttgggcaa tggcaaaggc cagatgcaca agcagagcca       360
     tatctgatcg ccaccggcgc agacaagcac ctccatctct tccaaacatc tcctggccat       420
     gacctcgtcc agtcattcac gggcacatca gaggccccaa ttctatcgta tatcccggtc       480
     caagatggga aatacatcct catgaccaat atgtcaggcc agcttcttct gcaaaaaggc       540
     gcagaaatca tagaccgccg caaggaccac gccaaatacg cggtcaaagt catcgcctac       600
     gaacagaaga acaacaacga cacagcagac accttttcca ccactacgac aatctggatt       660
     gcaacagcag gctgggactc caagatcttc ctctaccgca tgcagattaa cgatgaagcc       720
     cctacgcaaa tcggtgaccc cattgcctcc atcccattac tctccaatcc cgaatccatc       780
     ctcttcacca cccacatcga caaccctcag gacctaatcc tcctcgtctc ccgccgcgac       840
     tcaagcaacc tatactacta ccatgtcaaa ccgtcagcgg tctcaaccac cggatacgaa       900
     tgccctctca tcggtaaaca aaacctcgcc ccgcactcca acgcctgggt cgccttctcc       960
     ccctcctgtc tggccctcag ccctcatgac ccgggactca tagccatcgc aacatcaact      1020
     cttccgcata tgaaagttat gattgtgcgg ttgctcttcc cctcagcaga gagcttggag      1080
     tcaggctcgg cggagcagga acaggagcca gcaacgcaag cggcgcaggc tttcgctgcc      1140
     ctgtcgctgc agaatcgcga ggacgccgcg attctgatcc aggcgaatac gtttgcgccg      1200
     cagacggcgt actcgacgcc acaggttgtg tggagaccgg atgggtcggg ggtgtgggtt      1260
     aatggggatg atggggttgt gagggggttg gaggtgaaga cggggaaggt tgtgacgttg      1320
     ttgaaggatg ggcatgaggt tgggtgtaag attaggacgc tttgggcggg gtgggttgat      1380
     ggggagaatg ggggtgagag ggaggagtgg ttgttcagtt caattcacta tcaacctaca      1440
     tgggctacga ctcaagcgcg catggaaaag ataagcacgg agctgtacac acatatgcct      1500
     gtttcatcac caacttcatc atcaacttca ccaccaacca cactacggta tgagaaccgc      1560
     acgtcagaaa agcaaatgaa ccaccagcca cgggaatag                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page