(data stored in ACNUC7421 zone)

EMBL: AM269964.PE9

AM269964.PE9         Location/Qualifiers
FT   CDS_pept        complement(join(18097..18132,18206..18308,18586..18637,
FT                   18773..18779))
FT                   /locus_tag="An01g04920"
FT                   /note="Complex: S. cerevisiae L29 is part of the 60S
FT                   subunit of the ribosome."
FT                   /note="Function: S. cerevisiae ribosomal protein L29 is
FT                   involved in the biosynthesis of proteins."
FT                   /note="Remark: an alternative name for S. cerevisiae L29 is
FT                   YL34, or RPL29."
FT                   /note="Remark: the original reference for the isolation of
FT                   S. cerevisiae L29 is Otaka, E. ; Higo, K. I. ; Itoh, T;
FT                   Mol. Gen. Genet. 195: 544-546 (1984) which is not available
FT                   via PubMed."
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit L29 - Saccharomyces
FT                   cerevisiae"
FT                   /note="cytoplasm"
FT                   /note="See PMID 9008165"
FT                   /db_xref="GOA:A2Q8M9"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M9"
FT                   /inference="profile:PFAM:PF01779"
FT                   /inference="similar to AA sequence:PIR:S71066"
FT                   /protein_id="CAK37026.1"
FT                   /translation="MAKSKNASQHHNSQKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRH
FT                   ALHGTAKALKERKEGKREIA"
     atggcgaagt ccaagaacgc gtctcagcac cacaacagcc agaaggctca ccgtaacggt        60
     atcaagaagc ccaagaccca ccgttacccc tccctcaagg gtgtcgaccc caagttccgc       120
     cgcaaccaca gacacgccct tcacggaacc gctaaggctc tgaaggagcg caaggagggc       180
     aagcgcgaga tcgcataa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page