(data stored in ACNUC7421 zone)

EMBL: AM286690.ACPD

AM286690.ACPD        Location/Qualifiers
FT   CDS_pept        complement(29799..30395)
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="ABO_0027"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /function="converts holo-acp to apo-acp by hydrolytic
FT                   cleavage of the phosphopantetheine prosthetic group from
FT                   acp. its physiological function is not clear (by
FT                   similarity). holo-[acyl-carrier protein] + h(2)o =
FT                   4'-phosphopantetheine + apo-[acyl-carrier protein]."
FT                   /EC_number="3.1.4.14"
FT                   /note="(acyl carrier protein phosphodiesterase putative)
FT                   identified by sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15475"
FT                   /db_xref="GOA:Q0VTN3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTN3"
FT                   /protein_id="CAL15475.1"
FT                   /translation="MNILVIKSSVFGDNGNSSALVNAQVDALKAKHPQATVRVRDLSTD
FT                   PIPHLDGNRVSAFFTSATQRTDEQQAIDAFSLALIDEIKAADHIVLGLPMYNFGIPSQL
FT                   KSWIDHVARAGITFRYTEKGPQGLLENKPVTVLAARGGIYAGTSNDTVTPYIKLFFGFI
FT                   GITDVEFVFAEGLNMGDDVKEKALAVARSELLAST"
     atgaacattc tggtgatcaa aagcagcgtc tttggtgata acggtaattc ctccgcactg        60
     gttaatgcgc aggtagatgc gctgaaagcc aaacatccgc aagctacggt gcgcgtacga       120
     gacctgtcta cagatcccat tcctcaccta gacggtaatc gcgttagcgc ctttttcacc       180
     tcggcaacgc agcgcaccga cgaacagcaa gcgatcgacg cgttttcctt ggccctgatt       240
     gatgagatca aggcggcaga ccatattgtg ctgggccttc ccatgtacaa cttcggcatt       300
     cccagccagt tgaagagttg gattgatcac gtagcccgtg ccggaatcac ctttcgttat       360
     accgaaaagg ggccacaggg tttgctggaa aacaaacctg taacggtact agcagccaga       420
     gggggtatct atgccggcac cagcaacgat acggtcactc catatatcaa attgttcttc       480
     ggttttatcg gcatcaccga tgtggagttt gtattcgccg aagggttgaa catgggcgac       540
     gacgtcaaag aaaaagcgtt agctgtggcg cgttctgaac tactagcaag cacttga          597
//

If you have problems or comments...

PBIL Back to PBIL home page