(data stored in ACNUC7421 zone)

EMBL: AM286690.ALGA

AM286690.ALGA        Location/Qualifiers
FT   CDS_pept        complement(446677..448110)
FT                   /transl_table=11
FT                   /gene="algA"
FT                   /locus_tag="ABO_0395"
FT                   /product="mannose-6-phosphate isomerase /
FT                   mannose-1-phosphate guanylyl"
FT                   /function="produces a precursor for alginate
FT                   polymerization. catalitic activity: d-mannose 6-phosphate =
FT                   d-fructose 6- phosphate. gdp + d-mannose 1-phosphate =
FT                   phosphate + gdp- mannose."
FT                   /EC_number="2.7.7.22"
FT                   /note="(mannose-1-phosphateguanylyltransferase/mannose-6-p
FT                   hosphate isomerase) identified by match to PFAM protein
FT                   family HMMPF00483 InterPro: ADP-glucose pyrophosphorylase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15843"
FT                   /db_xref="GOA:Q0VSK5"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSK5"
FT                   /inference="protein motif:HMMPFAM:HMMPF00483"
FT                   /protein_id="CAL15843.1"
FT                   /translation="MLIPVIIAGGTGSRLWPLSRSHYPKQLLRLNGEFSMLQATILRLP
FT                   AELRAVRPIVVCNQEHRFLVAEQLQDIGIEADILLEPCGRNTAPAVALAALQARQRNTN
FT                   AKIFVCPADHAIRNPEALEETINVGCEAAETGLLVTFGIQPTRPETGYGYICMGEARGK
FT                   HHLIERFVEKPDAPTAQQFLDDGNYLWNSGMFLFRAERYLQELRERHPHMLAHCTHSLL
FT                   QAEADLDFIRLDEPSFARCEELSIDYAIMEHTADGAVVPVELLWNDLGSWQSLWDHLDK
FT                   DGDGNHLRGDIITHGSSNNLAISDDRLVALLGVEDLVVVDTPDAILVAHKSQAQEVKRI
FT                   TDTLKARKRPETENHRLVHRPWGKYDSLDKGNRYQVKHITVKPGEQLSVQMHHHRAEHW
FT                   IVVSGTAKVTCGEKTYLVAENQSTFIPIGEVHSLENPGRIPLELIEVQSGTYLGEDDII
FT                   RISDRYDRDDASKKVALLP"
     atgctgattc cagtcattat tgccggcggc accggctcac gcctgtggcc gctttctcgc        60
     tctcattacc ccaagcagtt gctgcgcctg aatggcgaat tcagcatgct gcaggccacg       120
     atcctgcgcc tccccgcaga attacgcgct gtacggccta ttgttgtctg taatcaagag       180
     caccgctttc tggttgcaga acaacttcaa gatattggca tcgaggccga cattttgctt       240
     gagccctgcg ggcgcaatac cgcaccagct gtggctctgg ccgcacttca ggctcgccaa       300
     cgcaacacca atgcgaaaat ctttgtttgc cctgcagacc atgccatccg taacccggag       360
     gcgctcgagg aaacgatcaa cgtcggctgc gaagcagctg aaaccggctt gctcgtcacc       420
     ttcggcatac aaccaacccg gccagaaacc ggatatgggt atatctgcat gggggaagcc       480
     cgcgggaaac accatctgat tgaacgcttt gtggaaaaac cagacgctcc caccgcgcaa       540
     cagttcctgg atgacggcaa ctatctatgg aacagtggca tgttcttgtt ccgagctgaa       600
     cgctatttac aggaattacg tgaacggcat ccacatatgc tagcccactg cactcactcc       660
     ttgcttcagg ctgaggccga ccttgatttt attcgcttag atgaacccag cttcgcccgc       720
     tgcgaagaac tgtccatcga ctatgccatt atggagcaca ccgctgacgg agctgtggtg       780
     cctgtagagc tactctggaa tgaccttggc tcctggcaat ccctgtggga tcatctcgac       840
     aaagatggcg acggcaatca tctgcgcggc gatatcatta cccatgggag cagcaataat       900
     ctagccatta gcgacgatcg cctcgttgcc ctgctcggcg tagaagatct ggtggtcgta       960
     gacaccccgg atgccattct ggtggcccac aagagtcaag cccaggaagt aaaacgcatt      1020
     accgacaccc tcaaggctcg caaacgacca gaaacagaga atcaccgcct tgttcaccgc      1080
     ccctggggca agtacgattc cttggacaaa ggcaatcgct atcaggtgaa gcacataacc      1140
     gtaaaacccg gcgaacagct ttctgtccag atgcaccacc accgggccga gcactggatt      1200
     gtggtttctg gtactgccaa agttacctgc ggggagaaga cgtacttggt tgcggagaac      1260
     cagtccacct tcattcctat cggcgaagtg cattcattgg agaatccagg ccgcattcct      1320
     ctcgaactga tcgaagtcca gtccggcacc tatctgggtg aagacgatat catccgtatc      1380
     agcgatcgct acgatcgcga tgacgcttca aaaaaagtgg cgcttctgcc atga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page